BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30823 (566 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 21 6.5 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 21 8.6 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 21.4 bits (43), Expect = 6.5 Identities = 9/42 (21%), Positives = 20/42 (47%) Frame = +3 Query: 432 LQKQSEQRDYYKILGVKRTATKTRDHKGVQEGSAESGTRDSY 557 + Q+ R+Y +I+ + +T +GV SA + + + Sbjct: 694 INNQTSTREYPRIMDLDNVMCRTSGPRGVAIVSASTARSEQF 735 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 21.0 bits (42), Expect = 8.6 Identities = 11/40 (27%), Positives = 17/40 (42%) Frame = +1 Query: 424 HRNCKNNPNKEIITKSWASRGRRRKQEITRAYRKAAQKVA 543 HR + P K+ TKSW+ + R +A K + Sbjct: 449 HRLGIDTPKKDGPTKSWSDESLNNALDALRTGTISANKAS 488 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 124,944 Number of Sequences: 438 Number of extensions: 2444 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 16440594 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -