BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30819 (971 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_36312| Best HMM Match : Ion_trans (HMM E-Value=0) 52 7e-07 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_17859| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 43 4e-04 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_33192| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_6726| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8) 42 8e-04 SB_36435| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_19304| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_28708| Best HMM Match : DapB_C (HMM E-Value=5.2) 42 0.001 SB_40073| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 41 0.001 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) 41 0.001 SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) 41 0.001 SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_44379| Best HMM Match : Peptidase_M28 (HMM E-Value=6.6e-11) 41 0.001 SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_19181| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_19004| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_9638| Best HMM Match : WD40 (HMM E-Value=8.4e-09) 41 0.001 SB_9445| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_7969| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_5286| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_55485| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_38869| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_38151| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_14383| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_7598| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_3084| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 40 0.002 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_58683| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_56140| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_53743| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_37676| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_29978| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_15848| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_14956| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_13552| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_12358| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_10647| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_5856| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) 40 0.002 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) 40 0.003 SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_18671| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_52926| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_47618| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_40987| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_33697| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_31700| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=6.8) 40 0.003 SB_27816| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_22981| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_20728| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_16374| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_16330| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_15205| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_11588| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_6535| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_4523| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_4204| Best HMM Match : DUF765 (HMM E-Value=8) 40 0.003 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 40 0.004 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 40 0.004 SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) 40 0.004 SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_59539| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_52392| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_50614| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_48029| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_44658| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_43133| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_42248| Best HMM Match : Keratin_B2 (HMM E-Value=4.4) 40 0.004 SB_40102| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_38659| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_37939| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_36967| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_35822| Best HMM Match : DUF765 (HMM E-Value=3.3) 40 0.004 SB_35501| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_34503| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_32645| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_32565| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_32003| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_28515| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_25053| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_23700| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_21702| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_19132| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_14766| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_14435| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_14039| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_13084| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_12674| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_12453| Best HMM Match : DUF765 (HMM E-Value=5) 40 0.004 SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) 40 0.004 SB_9111| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_9069| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_8550| Best HMM Match : MASE1 (HMM E-Value=1.5) 40 0.004 SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_3293| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_516| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 39 0.005 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) 39 0.005 SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) 39 0.005 SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_57030| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_53325| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_49519| Best HMM Match : DUF1378 (HMM E-Value=8.8) 39 0.005 SB_48240| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_47825| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_43874| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_43538| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) 39 0.005 SB_39977| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_39278| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_37610| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_37411| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_33166| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_30165| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_29275| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_27295| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_27058| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_26956| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_26923| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_26694| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_21311| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_20053| Best HMM Match : DUF765 (HMM E-Value=3.9) 39 0.005 SB_18140| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_17821| Best HMM Match : PQ-loop (HMM E-Value=6.7) 39 0.005 SB_17198| Best HMM Match : HEAT (HMM E-Value=1.8e-15) 39 0.005 SB_17162| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_13387| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_12908| Best HMM Match : Drf_FH1 (HMM E-Value=4.9) 39 0.005 SB_11350| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_9296| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_9153| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_8232| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_5754| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_5107| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_4657| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_3515| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_1885| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_1863| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_524| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_454| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 39 0.007 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_35698| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_7929| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_5250| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_4735| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_2138| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_1239| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_58005| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_54339| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_52596| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_52100| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_49201| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_48897| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_48738| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_46641| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_45361| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_45029| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_43244| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_42745| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_39410| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_39395| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_38625| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_38487| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_37889| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_36087| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_35028| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_33980| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_32750| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_30656| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_27903| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_26870| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_23203| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_20081| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_19538| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_17005| Best HMM Match : DUF765 (HMM E-Value=7.4) 39 0.007 SB_16339| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_16044| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_15013| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_14889| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_13185| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_12282| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_8422| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_7956| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_4499| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_2671| Best HMM Match : Amidohydro_2 (HMM E-Value=5.6) 39 0.007 SB_1805| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_1746| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_343| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 38 0.009 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 38 0.009 SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 38 0.009 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 38 0.009 SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) 38 0.009 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 38 0.009 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 38 0.009 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 38 0.009 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 38 0.009 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 38 0.009 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 38 0.009 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_35129| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 38 0.009 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) 38 0.009 SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) 38 0.009 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_26464| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_24337| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6) 38 0.009 SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_21366| Best HMM Match : YL1 (HMM E-Value=6.4) 38 0.009 SB_21293| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_20337| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) 38 0.009 SB_20039| Best HMM Match : LRR_1 (HMM E-Value=0.0061) 38 0.009 SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_17987| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_17701| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_16326| Best HMM Match : Sushi (HMM E-Value=5.4e-18) 38 0.009 SB_15961| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_15454| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_15306| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_14529| Best HMM Match : S10_plectin (HMM E-Value=5.8) 38 0.009 SB_14523| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_14086| Best HMM Match : POR (HMM E-Value=7.7) 38 0.009 SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_13728| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_13723| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_13641| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_13399| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_13203| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_13008| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_12959| Best HMM Match : Peptidase_M16_C (HMM E-Value=1e-14) 38 0.009 SB_12705| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_11081| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_10567| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_8860| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_8846| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_8191| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_7837| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_7279| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_7158| Best HMM Match : Copper-fist (HMM E-Value=7.1) 38 0.009 SB_6846| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_6413| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_6345| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_4586| Best HMM Match : DUF765 (HMM E-Value=7) 38 0.009 SB_4437| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_4105| Best HMM Match : WAP (HMM E-Value=0.0002) 38 0.009 SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) 38 0.009 SB_3149| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_2915| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_2869| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_2426| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_2195| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 38 0.009 SB_1540| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_1420| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_753| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_59569| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_59510| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_58686| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_58350| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_58237| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_57700| Best HMM Match : Parecho_VpG (HMM E-Value=7.7) 38 0.009 SB_56965| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_56894| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_56822| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_56549| Best HMM Match : Spermine_synth (HMM E-Value=1.5e-29) 38 0.009 SB_55260| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_55243| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_55208| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_55206| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_55086| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_55000| Best HMM Match : DUF765 (HMM E-Value=3.9) 38 0.009 SB_54502| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_54383| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_54347| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_54313| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_53934| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_53848| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_53639| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_53521| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_53415| Best HMM Match : efhand (HMM E-Value=2.7e-12) 38 0.009 >SB_36312| Best HMM Match : Ion_trans (HMM E-Value=0) Length = 1283 Score = 52.0 bits (119), Expect = 7e-07 Identities = 23/37 (62%), Positives = 32/37 (86%) Frame = +2 Query: 392 EKTAEEMTPEQKXAEKLRQQKLQEESDLRLAMETFGV 502 E+ +E+TPE++ AEKLR+QK+ EESDL +AM+TFGV Sbjct: 1181 EEEDKELTPEEQMAEKLRRQKIVEESDLLVAMDTFGV 1217 Score = 44.4 bits (100), Expect = 1e-04 Identities = 17/33 (51%), Positives = 23/33 (69%) Frame = +3 Query: 156 DADNFEPKLPTTLAASNKWEGEDEDDNVKESWE 254 D + FEP ++KWEGEDEDD++KESW+ Sbjct: 1097 DDEKFEPGEVPADGVTDKWEGEDEDDDIKESWD 1129 Score = 34.3 bits (75), Expect = 0.15 Identities = 13/28 (46%), Positives = 23/28 (82%) Frame = +1 Query: 523 LDNFHPTTKEEYTEFADLLTKKITFYKA 606 LD+ P+TKEE+TE++ LL +K+T +++ Sbjct: 1228 LDSMIPSTKEEFTEYSKLLVEKLTKFES 1255 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 44.8 bits (101), Expect = 1e-04 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = -2 Query: 82 KSDLVPNSCSPGDPLVLERPP 20 KSD V NSCSPGDPLVLERPP Sbjct: 3 KSDRVSNSCSPGDPLVLERPP 23 >SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 44.8 bits (101), Expect = 1e-04 Identities = 18/23 (78%), Positives = 21/23 (91%) Frame = -2 Query: 88 TPKSDLVPNSCSPGDPLVLERPP 20 +P++ LV NSCSPGDPLVLERPP Sbjct: 21 SPRARLVSNSCSPGDPLVLERPP 43 >SB_17859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 44.8 bits (101), Expect = 1e-04 Identities = 25/46 (54%), Positives = 28/46 (60%), Gaps = 1/46 (2%) Frame = -2 Query: 154 HDTSIFRTPESAAELI*KLFT*-TPKSDLVPNSCSPGDPLVLERPP 20 H T + TP S A KL T P + + NSCSPGDPLVLERPP Sbjct: 10 HATQLLETP-SIAIATHKLNTLFIPSTQMASNSCSPGDPLVLERPP 54 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 43.2 bits (97), Expect = 3e-04 Identities = 18/28 (64%), Positives = 22/28 (78%) Frame = -2 Query: 103 KLFT*TPKSDLVPNSCSPGDPLVLERPP 20 ++F+ +P S NSCSPGDPLVLERPP Sbjct: 70 QVFSQSPLSRFTSNSCSPGDPLVLERPP 97 >SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 43.2 bits (97), Expect = 3e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -2 Query: 76 DLVPNSCSPGDPLVLERPP 20 DL+ NSCSPGDPLVLERPP Sbjct: 36 DLISNSCSPGDPLVLERPP 54 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 42.7 bits (96), Expect = 4e-04 Identities = 22/44 (50%), Positives = 26/44 (59%) Frame = -2 Query: 151 DTSIFRTPESAAELI*KLFT*TPKSDLVPNSCSPGDPLVLERPP 20 DT F T ES + P ++ + NSCSPGDPLVLERPP Sbjct: 239 DTERFYTAESV-----EFLRENPVTEYISNSCSPGDPLVLERPP 277 >SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 42.3 bits (95), Expect = 6e-04 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = -2 Query: 88 TPKSDLVPNSCSPGDPLVLERPP 20 TP + + NSCSPGDPLVLERPP Sbjct: 15 TPNAGGISNSCSPGDPLVLERPP 37 >SB_33192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 42.3 bits (95), Expect = 6e-04 Identities = 23/43 (53%), Positives = 28/43 (65%), Gaps = 2/43 (4%) Frame = -1 Query: 143 HF*DSRISSRINMKTFHLNTKI--GPRAEFLQPGGSTSSRAAA 21 HF D+ IS+ I M+ + + G EFLQPGGSTSSRAAA Sbjct: 3 HFTDTLISANIAMRIIRIRFSLRSGYSIEFLQPGGSTSSRAAA 45 >SB_6726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 42.3 bits (95), Expect = 6e-04 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -2 Query: 79 SDLVPNSCSPGDPLVLERPP 20 +D V NSCSPGDPLVLERPP Sbjct: 14 ADFVSNSCSPGDPLVLERPP 33 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 41.9 bits (94), Expect = 8e-04 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = -2 Query: 82 KSDLVPNSCSPGDPLVLERPP 20 ++ LV NSCSPGDPLVLERPP Sbjct: 21 RAHLVSNSCSPGDPLVLERPP 41 >SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 41.9 bits (94), Expect = 8e-04 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -2 Query: 79 SDLVPNSCSPGDPLVLERPP 20 +D V NSCSPGDPLVLERPP Sbjct: 8 NDAVSNSCSPGDPLVLERPP 27 >SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8) Length = 210 Score = 41.9 bits (94), Expect = 8e-04 Identities = 22/46 (47%), Positives = 27/46 (58%), Gaps = 1/46 (2%) Frame = -2 Query: 154 HDTSIFRTPESAAELI*KLFT*TPKSD-LVPNSCSPGDPLVLERPP 20 +D + P + + L PKS+ L NSCSPGDPLVLERPP Sbjct: 57 YDVYRYLPPATQNSYVEYLHESVPKSEPLSSNSCSPGDPLVLERPP 102 >SB_36435| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 41.9 bits (94), Expect = 8e-04 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = -2 Query: 88 TPKSDLVPNSCSPGDPLVLERPP 20 T +S + NSCSPGDPLVLERPP Sbjct: 41 TTESTITSNSCSPGDPLVLERPP 63 >SB_19304| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 41.9 bits (94), Expect = 8e-04 Identities = 23/43 (53%), Positives = 27/43 (62%), Gaps = 2/43 (4%) Frame = -1 Query: 143 HF*DSRISSRINMKTFHLNTKIGPRA--EFLQPGGSTSSRAAA 21 HF D+ IS+ IN + K+ EFLQPGGSTSSRAAA Sbjct: 3 HFTDTLISANINKIRYQATNKLRNHCLIEFLQPGGSTSSRAAA 45 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 41.5 bits (93), Expect = 0.001 Identities = 18/23 (78%), Positives = 19/23 (82%) Frame = -2 Query: 88 TPKSDLVPNSCSPGDPLVLERPP 20 T KS + NSCSPGDPLVLERPP Sbjct: 95 TNKSLKISNSCSPGDPLVLERPP 117 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 41.5 bits (93), Expect = 0.001 Identities = 18/26 (69%), Positives = 19/26 (73%) Frame = -2 Query: 97 FT*TPKSDLVPNSCSPGDPLVLERPP 20 F P +L NSCSPGDPLVLERPP Sbjct: 12 FLSNPPKNLRSNSCSPGDPLVLERPP 37 >SB_28708| Best HMM Match : DapB_C (HMM E-Value=5.2) Length = 213 Score = 41.5 bits (93), Expect = 0.001 Identities = 22/36 (61%), Positives = 25/36 (69%) Frame = -1 Query: 128 RISSRINMKTFHLNTKIGPRAEFLQPGGSTSSRAAA 21 RI + F L+ K+G R EFLQPGGSTSSRAAA Sbjct: 121 RIIQSFYVDVFWLSVKVG-RIEFLQPGGSTSSRAAA 155 >SB_40073| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 41.5 bits (93), Expect = 0.001 Identities = 18/22 (81%), Positives = 19/22 (86%) Frame = -2 Query: 85 PKSDLVPNSCSPGDPLVLERPP 20 PK D+ NSCSPGDPLVLERPP Sbjct: 43 PK-DIASNSCSPGDPLVLERPP 63 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/23 (73%), Positives = 18/23 (78%) Frame = -2 Query: 88 TPKSDLVPNSCSPGDPLVLERPP 20 T L+ NSCSPGDPLVLERPP Sbjct: 28 TVSISLISNSCSPGDPLVLERPP 50 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/22 (77%), Positives = 18/22 (81%) Frame = -2 Query: 85 PKSDLVPNSCSPGDPLVLERPP 20 P+ D NSCSPGDPLVLERPP Sbjct: 376 PRVDRRSNSCSPGDPLVLERPP 397 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -2 Query: 79 SDLVPNSCSPGDPLVLERPP 20 S L+ NSCSPGDPLVLERPP Sbjct: 15 SFLISNSCSPGDPLVLERPP 34 >SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -2 Query: 73 LVPNSCSPGDPLVLERPP 20 LV NSCSPGDPLVLERPP Sbjct: 3 LVSNSCSPGDPLVLERPP 20 >SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 41.1 bits (92), Expect = 0.001 Identities = 16/22 (72%), Positives = 18/22 (81%) Frame = -2 Query: 85 PKSDLVPNSCSPGDPLVLERPP 20 P ++ NSCSPGDPLVLERPP Sbjct: 33 PYDNIASNSCSPGDPLVLERPP 54 >SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 346 Score = 41.1 bits (92), Expect = 0.001 Identities = 15/21 (71%), Positives = 19/21 (90%) Frame = -2 Query: 82 KSDLVPNSCSPGDPLVLERPP 20 + +++ NSCSPGDPLVLERPP Sbjct: 116 QKEIISNSCSPGDPLVLERPP 136 >SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -2 Query: 73 LVPNSCSPGDPLVLERPP 20 LV NSCSPGDPLVLERPP Sbjct: 17 LVSNSCSPGDPLVLERPP 34 >SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) Length = 180 Score = 41.1 bits (92), Expect = 0.001 Identities = 16/23 (69%), Positives = 19/23 (82%) Frame = -2 Query: 88 TPKSDLVPNSCSPGDPLVLERPP 20 +P ++ NSCSPGDPLVLERPP Sbjct: 50 SPLEPILSNSCSPGDPLVLERPP 72 >SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) Length = 190 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = -2 Query: 82 KSDLVPNSCSPGDPLVLERPP 20 KS NSCSPGDPLVLERPP Sbjct: 62 KSSTTSNSCSPGDPLVLERPP 82 >SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -2 Query: 73 LVPNSCSPGDPLVLERPP 20 LV NSCSPGDPLVLERPP Sbjct: 9 LVSNSCSPGDPLVLERPP 26 >SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/23 (73%), Positives = 18/23 (78%) Frame = -2 Query: 88 TPKSDLVPNSCSPGDPLVLERPP 20 T L+ NSCSPGDPLVLERPP Sbjct: 28 TVSISLISNSCSPGDPLVLERPP 50 >SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/23 (73%), Positives = 18/23 (78%) Frame = -2 Query: 88 TPKSDLVPNSCSPGDPLVLERPP 20 T L+ NSCSPGDPLVLERPP Sbjct: 28 TVSISLISNSCSPGDPLVLERPP 50 >SB_44379| Best HMM Match : Peptidase_M28 (HMM E-Value=6.6e-11) Length = 1098 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/26 (65%), Positives = 20/26 (76%) Frame = -2 Query: 97 FT*TPKSDLVPNSCSPGDPLVLERPP 20 FT + + + NSCSPGDPLVLERPP Sbjct: 965 FTVSRRKGWISNSCSPGDPLVLERPP 990 >SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -2 Query: 73 LVPNSCSPGDPLVLERPP 20 LV NSCSPGDPLVLERPP Sbjct: 5 LVSNSCSPGDPLVLERPP 22 >SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/23 (73%), Positives = 18/23 (78%) Frame = -2 Query: 88 TPKSDLVPNSCSPGDPLVLERPP 20 T L+ NSCSPGDPLVLERPP Sbjct: 28 TVSISLISNSCSPGDPLVLERPP 50 >SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/23 (73%), Positives = 18/23 (78%) Frame = -2 Query: 88 TPKSDLVPNSCSPGDPLVLERPP 20 T L+ NSCSPGDPLVLERPP Sbjct: 28 TVSISLISNSCSPGDPLVLERPP 50 >SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -2 Query: 73 LVPNSCSPGDPLVLERPP 20 LV NSCSPGDPLVLERPP Sbjct: 2 LVSNSCSPGDPLVLERPP 19 >SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/23 (73%), Positives = 18/23 (78%) Frame = -2 Query: 88 TPKSDLVPNSCSPGDPLVLERPP 20 T L+ NSCSPGDPLVLERPP Sbjct: 28 TVSISLISNSCSPGDPLVLERPP 50 >SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/23 (73%), Positives = 18/23 (78%) Frame = -2 Query: 88 TPKSDLVPNSCSPGDPLVLERPP 20 T L+ NSCSPGDPLVLERPP Sbjct: 29 TVSISLISNSCSPGDPLVLERPP 51 >SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/35 (60%), Positives = 23/35 (65%) Frame = -2 Query: 124 SAAELI*KLFT*TPKSDLVPNSCSPGDPLVLERPP 20 SA +L+ KL L NSCSPGDPLVLERPP Sbjct: 71 SANKLMRKLAVDASNLLLTSNSCSPGDPLVLERPP 105 >SB_19181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 41.1 bits (92), Expect = 0.001 Identities = 16/23 (69%), Positives = 19/23 (82%) Frame = -2 Query: 88 TPKSDLVPNSCSPGDPLVLERPP 20 T + ++ NSCSPGDPLVLERPP Sbjct: 12 TTSAPVISNSCSPGDPLVLERPP 34 >SB_19004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 41.1 bits (92), Expect = 0.001 Identities = 16/20 (80%), Positives = 19/20 (95%) Frame = -2 Query: 79 SDLVPNSCSPGDPLVLERPP 20 +++V NSCSPGDPLVLERPP Sbjct: 11 ANIVSNSCSPGDPLVLERPP 30 >SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -2 Query: 73 LVPNSCSPGDPLVLERPP 20 LV NSCSPGDPLVLERPP Sbjct: 26 LVSNSCSPGDPLVLERPP 43 >SB_9638| Best HMM Match : WD40 (HMM E-Value=8.4e-09) Length = 781 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/22 (77%), Positives = 17/22 (77%) Frame = -2 Query: 85 PKSDLVPNSCSPGDPLVLERPP 20 P S NSCSPGDPLVLERPP Sbjct: 510 PSSSTPSNSCSPGDPLVLERPP 531 Score = 29.1 bits (62), Expect = 5.7 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 52 PGDPLVLERPP 20 PGDPLVLERPP Sbjct: 664 PGDPLVLERPP 674 >SB_9445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 41.1 bits (92), Expect = 0.001 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -2 Query: 76 DLVPNSCSPGDPLVLERPP 20 D+ NSCSPGDPLVLERPP Sbjct: 19 DIASNSCSPGDPLVLERPP 37 >SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/23 (73%), Positives = 18/23 (78%) Frame = -2 Query: 88 TPKSDLVPNSCSPGDPLVLERPP 20 T L+ NSCSPGDPLVLERPP Sbjct: 28 TVSISLISNSCSPGDPLVLERPP 50 >SB_7969| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 41.1 bits (92), Expect = 0.001 Identities = 16/22 (72%), Positives = 19/22 (86%) Frame = -2 Query: 85 PKSDLVPNSCSPGDPLVLERPP 20 P++ + NSCSPGDPLVLERPP Sbjct: 28 PENKALSNSCSPGDPLVLERPP 49 >SB_5286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = -2 Query: 82 KSDLVPNSCSPGDPLVLERPP 20 +S L NSCSPGDPLVLERPP Sbjct: 8 ESGLTSNSCSPGDPLVLERPP 28 >SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/23 (73%), Positives = 18/23 (78%) Frame = -2 Query: 88 TPKSDLVPNSCSPGDPLVLERPP 20 T L+ NSCSPGDPLVLERPP Sbjct: 26 TVSISLISNSCSPGDPLVLERPP 48 >SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/27 (74%), Positives = 21/27 (77%), Gaps = 1/27 (3%) Frame = -2 Query: 97 FT*TPKSD-LVPNSCSPGDPLVLERPP 20 FT K+D L NSCSPGDPLVLERPP Sbjct: 14 FTGHAKNDALSSNSCSPGDPLVLERPP 40 >SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/20 (80%), Positives = 18/20 (90%) Frame = -2 Query: 79 SDLVPNSCSPGDPLVLERPP 20 +D + NSCSPGDPLVLERPP Sbjct: 5 TDTLSNSCSPGDPLVLERPP 24 >SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -2 Query: 73 LVPNSCSPGDPLVLERPP 20 L+ NSCSPGDPLVLERPP Sbjct: 8 LISNSCSPGDPLVLERPP 25 >SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 76 DLVPNSCSPGDPLVLERPP 20 D V NSCSPGDPLVLERPP Sbjct: 1 DPVSNSCSPGDPLVLERPP 19 >SB_55485| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 40.7 bits (91), Expect = 0.002 Identities = 23/43 (53%), Positives = 28/43 (65%), Gaps = 2/43 (4%) Frame = -1 Query: 143 HF*DSRISSRINMKTFHLNTKI--GPRAEFLQPGGSTSSRAAA 21 HF D+ IS+ I + + +I P EFLQPGGSTSSRAAA Sbjct: 3 HFTDTLISANIKIIFQEADQEIQYNPEIEFLQPGGSTSSRAAA 45 >SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 40.7 bits (91), Expect = 0.002 Identities = 15/20 (75%), Positives = 19/20 (95%) Frame = -2 Query: 79 SDLVPNSCSPGDPLVLERPP 20 ++++ NSCSPGDPLVLERPP Sbjct: 11 ANIISNSCSPGDPLVLERPP 30 >SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -2 Query: 73 LVPNSCSPGDPLVLERPP 20 L+ NSCSPGDPLVLERPP Sbjct: 33 LISNSCSPGDPLVLERPP 50 >SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 76 DLVPNSCSPGDPLVLERPP 20 D V NSCSPGDPLVLERPP Sbjct: 13 DEVSNSCSPGDPLVLERPP 31 >SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -2 Query: 73 LVPNSCSPGDPLVLERPP 20 L+ NSCSPGDPLVLERPP Sbjct: 24 LISNSCSPGDPLVLERPP 41 >SB_38869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 40.7 bits (91), Expect = 0.002 Identities = 21/29 (72%), Positives = 22/29 (75%), Gaps = 1/29 (3%) Frame = -2 Query: 103 KLFT*TPKSDLVP-NSCSPGDPLVLERPP 20 K FT T S +P NSCSPGDPLVLERPP Sbjct: 2 KHFTDTLISANIPSNSCSPGDPLVLERPP 30 >SB_38151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -2 Query: 79 SDLVPNSCSPGDPLVLERPP 20 S+ V NSCSPGDPLVLERPP Sbjct: 38 SENVSNSCSPGDPLVLERPP 57 >SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -2 Query: 73 LVPNSCSPGDPLVLERPP 20 L+ NSCSPGDPLVLERPP Sbjct: 40 LISNSCSPGDPLVLERPP 57 >SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -2 Query: 73 LVPNSCSPGDPLVLERPP 20 L+ NSCSPGDPLVLERPP Sbjct: 70 LISNSCSPGDPLVLERPP 87 >SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -2 Query: 73 LVPNSCSPGDPLVLERPP 20 L+ NSCSPGDPLVLERPP Sbjct: 21 LISNSCSPGDPLVLERPP 38 >SB_14383| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/27 (62%), Positives = 21/27 (77%) Frame = -2 Query: 100 LFT*TPKSDLVPNSCSPGDPLVLERPP 20 +F+ + + V NSCSPGDPLVLERPP Sbjct: 13 IFSEPKRVNAVSNSCSPGDPLVLERPP 39 >SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -2 Query: 73 LVPNSCSPGDPLVLERPP 20 L+ NSCSPGDPLVLERPP Sbjct: 16 LISNSCSPGDPLVLERPP 33 >SB_7598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 40.7 bits (91), Expect = 0.002 Identities = 15/20 (75%), Positives = 19/20 (95%) Frame = -2 Query: 79 SDLVPNSCSPGDPLVLERPP 20 ++++ NSCSPGDPLVLERPP Sbjct: 11 ANIISNSCSPGDPLVLERPP 30 >SB_3084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 40.7 bits (91), Expect = 0.002 Identities = 21/29 (72%), Positives = 22/29 (75%), Gaps = 1/29 (3%) Frame = -2 Query: 103 KLFT*TPKSDLVP-NSCSPGDPLVLERPP 20 K FT T S +P NSCSPGDPLVLERPP Sbjct: 2 KHFTDTLISANIPSNSCSPGDPLVLERPP 30 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -2 Query: 73 LVPNSCSPGDPLVLERPP 20 +V NSCSPGDPLVLERPP Sbjct: 347 IVSNSCSPGDPLVLERPP 364 >SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 40.3 bits (90), Expect = 0.002 Identities = 23/41 (56%), Positives = 28/41 (68%) Frame = -1 Query: 143 HF*DSRISSRINMKTFHLNTKIGPRAEFLQPGGSTSSRAAA 21 HF D+ IS+ I+ ++ K P EFLQPGGSTSSRAAA Sbjct: 3 HFTDTLISANIHC----VDVKAYPCIEFLQPGGSTSSRAAA 39 >SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/20 (80%), Positives = 18/20 (90%) Frame = -2 Query: 79 SDLVPNSCSPGDPLVLERPP 20 +D + NSCSPGDPLVLERPP Sbjct: 21 TDRLSNSCSPGDPLVLERPP 40 >SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -2 Query: 73 LVPNSCSPGDPLVLERPP 20 +V NSCSPGDPLVLERPP Sbjct: 77 IVSNSCSPGDPLVLERPP 94 >SB_58683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 40.3 bits (90), Expect = 0.002 Identities = 17/22 (77%), Positives = 17/22 (77%) Frame = -2 Query: 85 PKSDLVPNSCSPGDPLVLERPP 20 P L NSCSPGDPLVLERPP Sbjct: 23 PGKHLPSNSCSPGDPLVLERPP 44 >SB_56140| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 40.3 bits (90), Expect = 0.002 Identities = 24/42 (57%), Positives = 27/42 (64%), Gaps = 1/42 (2%) Frame = -1 Query: 143 HF*DSRISSRI-NMKTFHLNTKIGPRAEFLQPGGSTSSRAAA 21 HF D+ IS+ I N K + I EFLQPGGSTSSRAAA Sbjct: 3 HFTDTLISANIQNTKCAKASILINCFIEFLQPGGSTSSRAAA 44 >SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = -2 Query: 82 KSDLVPNSCSPGDPLVLERPP 20 K+ + NSCSPGDPLVLERPP Sbjct: 43 KNFFISNSCSPGDPLVLERPP 63 >SB_53743| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -2 Query: 76 DLVPNSCSPGDPLVLERPP 20 D + NSCSPGDPLVLERPP Sbjct: 5 DEISNSCSPGDPLVLERPP 23 >SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -2 Query: 73 LVPNSCSPGDPLVLERPP 20 +V NSCSPGDPLVLERPP Sbjct: 11 MVSNSCSPGDPLVLERPP 28 >SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -2 Query: 73 LVPNSCSPGDPLVLERPP 20 +V NSCSPGDPLVLERPP Sbjct: 1 MVSNSCSPGDPLVLERPP 18 >SB_37676| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = -2 Query: 82 KSDLVPNSCSPGDPLVLERPP 20 K ++ NSCSPGDPLVLERPP Sbjct: 10 KRQVLSNSCSPGDPLVLERPP 30 >SB_29978| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -2 Query: 76 DLVPNSCSPGDPLVLERPP 20 +L NSCSPGDPLVLERPP Sbjct: 10 ELTSNSCSPGDPLVLERPP 28 >SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 210 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -2 Query: 73 LVPNSCSPGDPLVLERPP 20 +V NSCSPGDPLVLERPP Sbjct: 85 IVSNSCSPGDPLVLERPP 102 >SB_15848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/20 (80%), Positives = 18/20 (90%) Frame = -2 Query: 79 SDLVPNSCSPGDPLVLERPP 20 S+ + NSCSPGDPLVLERPP Sbjct: 60 SNFLSNSCSPGDPLVLERPP 79 >SB_14956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -2 Query: 73 LVPNSCSPGDPLVLERPP 20 +V NSCSPGDPLVLERPP Sbjct: 6 IVSNSCSPGDPLVLERPP 23 >SB_13552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 40.3 bits (90), Expect = 0.002 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -2 Query: 79 SDLVPNSCSPGDPLVLERPP 20 S L+ NSCSPGDPLVLERPP Sbjct: 5 SFLLSNSCSPGDPLVLERPP 24 >SB_12358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -2 Query: 73 LVPNSCSPGDPLVLERPP 20 +V NSCSPGDPLVLERPP Sbjct: 1 MVSNSCSPGDPLVLERPP 18 >SB_10647| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 40.3 bits (90), Expect = 0.002 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = -2 Query: 82 KSDLVPNSCSPGDPLVLERPP 20 K D NSCSPGDPLVLERPP Sbjct: 4 KGDRRSNSCSPGDPLVLERPP 24 >SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/26 (69%), Positives = 19/26 (73%) Frame = -2 Query: 97 FT*TPKSDLVPNSCSPGDPLVLERPP 20 F T +V NSCSPGDPLVLERPP Sbjct: 19 FVYTVIQKVVSNSCSPGDPLVLERPP 44 >SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/23 (78%), Positives = 18/23 (78%) Frame = -2 Query: 88 TPKSDLVPNSCSPGDPLVLERPP 20 T K V NSCSPGDPLVLERPP Sbjct: 3 TSKMLRVSNSCSPGDPLVLERPP 25 >SB_5856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = -2 Query: 94 T*TPKSDLVPNSCSPGDPLVLERPP 20 T T S ++ NSCSPGDPLVLERPP Sbjct: 19 TFTLGSLIISNSCSPGDPLVLERPP 43 >SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) Length = 221 Score = 40.3 bits (90), Expect = 0.002 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = -2 Query: 82 KSDLVPNSCSPGDPLVLERPP 20 K L NSCSPGDPLVLERPP Sbjct: 93 KRALASNSCSPGDPLVLERPP 113 >SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 39.9 bits (89), Expect = 0.003 Identities = 15/18 (83%), Positives = 17/18 (94%) Frame = -2 Query: 73 LVPNSCSPGDPLVLERPP 20 ++ NSCSPGDPLVLERPP Sbjct: 17 IISNSCSPGDPLVLERPP 34 >SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 39.9 bits (89), Expect = 0.003 Identities = 25/41 (60%), Positives = 27/41 (65%) Frame = -1 Query: 143 HF*DSRISSRINMKTFHLNTKIGPRAEFLQPGGSTSSRAAA 21 HF D+ IS+ I F TK P EFLQPGGSTSSRAAA Sbjct: 3 HFTDTLISANIVYLLFDA-TK--PSIEFLQPGGSTSSRAAA 40 >SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 39.9 bits (89), Expect = 0.003 Identities = 22/41 (53%), Positives = 27/41 (65%) Frame = -1 Query: 143 HF*DSRISSRINMKTFHLNTKIGPRAEFLQPGGSTSSRAAA 21 HF D+ IS+ I + + + P EFLQPGGSTSSRAAA Sbjct: 3 HFTDTLISANIGLC---VKSASSPMIEFLQPGGSTSSRAAA 40 >SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 39.9 bits (89), Expect = 0.003 Identities = 16/22 (72%), Positives = 18/22 (81%) Frame = -2 Query: 85 PKSDLVPNSCSPGDPLVLERPP 20 P + + NSCSPGDPLVLERPP Sbjct: 57 PTAKKLSNSCSPGDPLVLERPP 78 >SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 39.9 bits (89), Expect = 0.003 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -2 Query: 73 LVPNSCSPGDPLVLERPP 20 L+ NSCSPGDPLVLERPP Sbjct: 62 LLSNSCSPGDPLVLERPP 79 >SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 39.9 bits (89), Expect = 0.003 Identities = 15/20 (75%), Positives = 19/20 (95%) Frame = -2 Query: 79 SDLVPNSCSPGDPLVLERPP 20 ++++ NSCSPGDPLVLERPP Sbjct: 11 ANILSNSCSPGDPLVLERPP 30 >SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) Length = 332 Score = 39.9 bits (89), Expect = 0.003 Identities = 16/20 (80%), Positives = 18/20 (90%) Frame = -2 Query: 79 SDLVPNSCSPGDPLVLERPP 20 S++ NSCSPGDPLVLERPP Sbjct: 19 SNISSNSCSPGDPLVLERPP 38 >SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 39.9 bits (89), Expect = 0.003 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = -2 Query: 94 T*TPKSDLVPNSCSPGDPLVLERPP 20 T T +S NSCSPGDPLVLERPP Sbjct: 11 TETGRSACPSNSCSPGDPLVLERPP 35 >SB_18671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 39.9 bits (89), Expect = 0.003 Identities = 17/23 (73%), Positives = 17/23 (73%) Frame = +1 Query: 22 AAALELVDPPGCRNSARGPILVF 90 AAALELVDPPGCRNS P F Sbjct: 10 AAALELVDPPGCRNSMSNPFAAF 32 >SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3889 Score = 39.9 bits (89), Expect = 0.003 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -2 Query: 73 LVPNSCSPGDPLVLERPP 20 +V NSCSPGDPLVLERPP Sbjct: 3474 VVSNSCSPGDPLVLERPP 3491 >SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 39.9 bits (89), Expect = 0.003 Identities = 15/18 (83%), Positives = 17/18 (94%) Frame = -2 Query: 73 LVPNSCSPGDPLVLERPP 20 ++ NSCSPGDPLVLERPP Sbjct: 14 IISNSCSPGDPLVLERPP 31 >SB_52926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 39.9 bits (89), Expect = 0.003 Identities = 18/28 (64%), Positives = 19/28 (67%) Frame = -2 Query: 103 KLFT*TPKSDLVPNSCSPGDPLVLERPP 20 K +T D NSCSPGDPLVLERPP Sbjct: 52 KSYTEDDYLDWTSNSCSPGDPLVLERPP 79 >SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 39.9 bits (89), Expect = 0.003 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -2 Query: 73 LVPNSCSPGDPLVLERPP 20 +V NSCSPGDPLVLERPP Sbjct: 7 VVSNSCSPGDPLVLERPP 24 >SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 39.9 bits (89), Expect = 0.003 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -2 Query: 73 LVPNSCSPGDPLVLERPP 20 L+ NSCSPGDPLVLERPP Sbjct: 54 LLSNSCSPGDPLVLERPP 71 >SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 39.9 bits (89), Expect = 0.003 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -2 Query: 73 LVPNSCSPGDPLVLERPP 20 L+ NSCSPGDPLVLERPP Sbjct: 2 LLSNSCSPGDPLVLERPP 19 >SB_47618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 39.9 bits (89), Expect = 0.003 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = -2 Query: 82 KSDLVPNSCSPGDPLVLERPP 20 K+ + NSCSPGDPLVLERPP Sbjct: 3 KNSQLSNSCSPGDPLVLERPP 23 >SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 39.9 bits (89), Expect = 0.003 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -2 Query: 73 LVPNSCSPGDPLVLERPP 20 L+ NSCSPGDPLVLERPP Sbjct: 6 LLSNSCSPGDPLVLERPP 23 >SB_40987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 176 Score = 39.9 bits (89), Expect = 0.003 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -2 Query: 76 DLVPNSCSPGDPLVLERPP 20 D NSCSPGDPLVLERPP Sbjct: 50 DTTSNSCSPGDPLVLERPP 68 >SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 39.9 bits (89), Expect = 0.003 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -2 Query: 73 LVPNSCSPGDPLVLERPP 20 +V NSCSPGDPLVLERPP Sbjct: 19 VVSNSCSPGDPLVLERPP 36 >SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 39.9 bits (89), Expect = 0.003 Identities = 15/18 (83%), Positives = 17/18 (94%) Frame = -2 Query: 73 LVPNSCSPGDPLVLERPP 20 ++ NSCSPGDPLVLERPP Sbjct: 5 IISNSCSPGDPLVLERPP 22 >SB_33697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 39.9 bits (89), Expect = 0.003 Identities = 15/19 (78%), Positives = 18/19 (94%) Frame = -2 Query: 76 DLVPNSCSPGDPLVLERPP 20 +++ NSCSPGDPLVLERPP Sbjct: 4 NVISNSCSPGDPLVLERPP 22 >SB_31700| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=6.8) Length = 126 Score = 39.9 bits (89), Expect = 0.003 Identities = 18/25 (72%), Positives = 21/25 (84%) Frame = -2 Query: 94 T*TPKSDLVPNSCSPGDPLVLERPP 20 T +P+S + NSCSPGDPLVLERPP Sbjct: 26 TESPRS--ISNSCSPGDPLVLERPP 48 >SB_27816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 39.9 bits (89), Expect = 0.003 Identities = 17/22 (77%), Positives = 17/22 (77%) Frame = -2 Query: 85 PKSDLVPNSCSPGDPLVLERPP 20 P S NSCSPGDPLVLERPP Sbjct: 86 PPSVSTSNSCSPGDPLVLERPP 107 >SB_22981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 39.9 bits (89), Expect = 0.003 Identities = 15/18 (83%), Positives = 17/18 (94%) Frame = -2 Query: 73 LVPNSCSPGDPLVLERPP 20 ++ NSCSPGDPLVLERPP Sbjct: 1 MISNSCSPGDPLVLERPP 18 >SB_20728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 39.9 bits (89), Expect = 0.003 Identities = 21/41 (51%), Positives = 25/41 (60%) Frame = -1 Query: 143 HF*DSRISSRINMKTFHLNTKIGPRAEFLQPGGSTSSRAAA 21 HF D+ IS+ I+ + EFLQPGGSTSSRAAA Sbjct: 3 HFTDTLISANISFIKVKFGVFLLKNIEFLQPGGSTSSRAAA 43 >SB_16374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 39.9 bits (89), Expect = 0.003 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -2 Query: 73 LVPNSCSPGDPLVLERPP 20 L+ NSCSPGDPLVLERPP Sbjct: 1 LLSNSCSPGDPLVLERPP 18 >SB_16330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 39.9 bits (89), Expect = 0.003 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -2 Query: 76 DLVPNSCSPGDPLVLERPP 20 + V NSCSPGDPLVLERPP Sbjct: 6 EAVSNSCSPGDPLVLERPP 24 >SB_15205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 39.9 bits (89), Expect = 0.003 Identities = 15/18 (83%), Positives = 17/18 (94%) Frame = -2 Query: 73 LVPNSCSPGDPLVLERPP 20 ++ NSCSPGDPLVLERPP Sbjct: 4 IISNSCSPGDPLVLERPP 21 >SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 39.9 bits (89), Expect = 0.003 Identities = 18/19 (94%), Positives = 18/19 (94%), Gaps = 1/19 (5%) Frame = -2 Query: 73 LVP-NSCSPGDPLVLERPP 20 LVP NSCSPGDPLVLERPP Sbjct: 27 LVPSNSCSPGDPLVLERPP 45 >SB_11588| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 39.9 bits (89), Expect = 0.003 Identities = 19/24 (79%), Positives = 20/24 (83%), Gaps = 3/24 (12%) Frame = -2 Query: 82 KSDLV---PNSCSPGDPLVLERPP 20 K+DLV NSCSPGDPLVLERPP Sbjct: 7 KADLVIKTSNSCSPGDPLVLERPP 30 >SB_6535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 39.9 bits (89), Expect = 0.003 Identities = 18/21 (85%), Positives = 19/21 (90%), Gaps = 1/21 (4%) Frame = -2 Query: 79 SDLVP-NSCSPGDPLVLERPP 20 SD+V NSCSPGDPLVLERPP Sbjct: 9 SDIVASNSCSPGDPLVLERPP 29 >SB_4523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 39.9 bits (89), Expect = 0.003 Identities = 16/23 (69%), Positives = 17/23 (73%) Frame = -2 Query: 88 TPKSDLVPNSCSPGDPLVLERPP 20 T + NSCSPGDPLVLERPP Sbjct: 39 TSNKPTISNSCSPGDPLVLERPP 61 >SB_4204| Best HMM Match : DUF765 (HMM E-Value=8) Length = 144 Score = 39.9 bits (89), Expect = 0.003 Identities = 16/21 (76%), Positives = 17/21 (80%) Frame = -2 Query: 82 KSDLVPNSCSPGDPLVLERPP 20 K + NSCSPGDPLVLERPP Sbjct: 16 KVSITSNSCSPGDPLVLERPP 36 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 39.5 bits (88), Expect = 0.004 Identities = 15/20 (75%), Positives = 18/20 (90%) Frame = -2 Query: 79 SDLVPNSCSPGDPLVLERPP 20 +++ NSCSPGDPLVLERPP Sbjct: 11 ANIASNSCSPGDPLVLERPP 30 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -2 Query: 70 VPNSCSPGDPLVLERPP 20 V NSCSPGDPLVLERPP Sbjct: 30 VSNSCSPGDPLVLERPP 46 >SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) Length = 295 Score = 39.5 bits (88), Expect = 0.004 Identities = 22/40 (55%), Positives = 29/40 (72%), Gaps = 3/40 (7%) Frame = -1 Query: 131 SRISSRINMKT---FHLNTKIGPRAEFLQPGGSTSSRAAA 21 S ++ RIN+ +H +++ GP EFLQPGGSTSSRAAA Sbjct: 88 SAMADRINILRKGKWHSSSR-GPNIEFLQPGGSTSSRAAA 126 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -2 Query: 70 VPNSCSPGDPLVLERPP 20 V NSCSPGDPLVLERPP Sbjct: 10 VSNSCSPGDPLVLERPP 26 >SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) Length = 139 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -2 Query: 70 VPNSCSPGDPLVLERPP 20 V NSCSPGDPLVLERPP Sbjct: 15 VSNSCSPGDPLVLERPP 31 >SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -2 Query: 70 VPNSCSPGDPLVLERPP 20 V NSCSPGDPLVLERPP Sbjct: 2 VSNSCSPGDPLVLERPP 18 >SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 39.5 bits (88), Expect = 0.004 Identities = 18/22 (81%), Positives = 18/22 (81%) Frame = -2 Query: 85 PKSDLVPNSCSPGDPLVLERPP 20 PKS NSCSPGDPLVLERPP Sbjct: 2 PKSG-ASNSCSPGDPLVLERPP 22 >SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 73 LVPNSCSPGDPLVLERPP 20 L NSCSPGDPLVLERPP Sbjct: 15 LTSNSCSPGDPLVLERPP 32 >SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1010 Score = 39.5 bits (88), Expect = 0.004 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = -2 Query: 82 KSDLVPNSCSPGDPLVLERPP 20 + + NSCSPGDPLVLERPP Sbjct: 79 RQQMASNSCSPGDPLVLERPP 99 >SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -2 Query: 70 VPNSCSPGDPLVLERPP 20 V NSCSPGDPLVLERPP Sbjct: 40 VSNSCSPGDPLVLERPP 56 >SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 241 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -2 Query: 70 VPNSCSPGDPLVLERPP 20 V NSCSPGDPLVLERPP Sbjct: 117 VSNSCSPGDPLVLERPP 133 >SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 308 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -2 Query: 70 VPNSCSPGDPLVLERPP 20 V NSCSPGDPLVLERPP Sbjct: 184 VSNSCSPGDPLVLERPP 200 >SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -2 Query: 70 VPNSCSPGDPLVLERPP 20 V NSCSPGDPLVLERPP Sbjct: 34 VSNSCSPGDPLVLERPP 50 >SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1407 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -2 Query: 70 VPNSCSPGDPLVLERPP 20 V NSCSPGDPLVLERPP Sbjct: 1066 VSNSCSPGDPLVLERPP 1082 >SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 39.5 bits (88), Expect = 0.004 Identities = 15/18 (83%), Positives = 17/18 (94%) Frame = -2 Query: 73 LVPNSCSPGDPLVLERPP 20 ++ NSCSPGDPLVLERPP Sbjct: 14 VISNSCSPGDPLVLERPP 31 >SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 447 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 73 LVPNSCSPGDPLVLERPP 20 L NSCSPGDPLVLERPP Sbjct: 78 LTSNSCSPGDPLVLERPP 95 >SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -2 Query: 70 VPNSCSPGDPLVLERPP 20 V NSCSPGDPLVLERPP Sbjct: 3 VSNSCSPGDPLVLERPP 19 >SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) Length = 680 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -2 Query: 70 VPNSCSPGDPLVLERPP 20 V NSCSPGDPLVLERPP Sbjct: 214 VSNSCSPGDPLVLERPP 230 >SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -2 Query: 70 VPNSCSPGDPLVLERPP 20 V NSCSPGDPLVLERPP Sbjct: 32 VSNSCSPGDPLVLERPP 48 >SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 73 LVPNSCSPGDPLVLERPP 20 L NSCSPGDPLVLERPP Sbjct: 5 LASNSCSPGDPLVLERPP 22 >SB_59539| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = -2 Query: 85 PKSDLVPNSCSPGDPLVLERPP 20 P + NSCSPGDPLVLERPP Sbjct: 30 PNATAQSNSCSPGDPLVLERPP 51 >SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -2 Query: 70 VPNSCSPGDPLVLERPP 20 V NSCSPGDPLVLERPP Sbjct: 5 VSNSCSPGDPLVLERPP 21 >SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/23 (69%), Positives = 18/23 (78%) Frame = -2 Query: 88 TPKSDLVPNSCSPGDPLVLERPP 20 +P+ NSCSPGDPLVLERPP Sbjct: 2 SPEKSRRSNSCSPGDPLVLERPP 24 >SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -2 Query: 70 VPNSCSPGDPLVLERPP 20 V NSCSPGDPLVLERPP Sbjct: 7 VSNSCSPGDPLVLERPP 23 >SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -2 Query: 70 VPNSCSPGDPLVLERPP 20 V NSCSPGDPLVLERPP Sbjct: 64 VSNSCSPGDPLVLERPP 80 >SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1584 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/26 (73%), Positives = 20/26 (76%), Gaps = 3/26 (11%) Frame = -2 Query: 88 TPKSDLVP---NSCSPGDPLVLERPP 20 T +DL P NSCSPGDPLVLERPP Sbjct: 1184 TKGNDLKPFASNSCSPGDPLVLERPP 1209 >SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -2 Query: 70 VPNSCSPGDPLVLERPP 20 V NSCSPGDPLVLERPP Sbjct: 4 VSNSCSPGDPLVLERPP 20 >SB_52392| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 39.5 bits (88), Expect = 0.004 Identities = 17/22 (77%), Positives = 18/22 (81%) Frame = -2 Query: 85 PKSDLVPNSCSPGDPLVLERPP 20 P + L NSCSPGDPLVLERPP Sbjct: 14 PLTILGSNSCSPGDPLVLERPP 35 >SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 73 LVPNSCSPGDPLVLERPP 20 L NSCSPGDPLVLERPP Sbjct: 6 LASNSCSPGDPLVLERPP 23 >SB_50614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/20 (80%), Positives = 18/20 (90%) Frame = -2 Query: 79 SDLVPNSCSPGDPLVLERPP 20 +D + NSCSPGDPLVLERPP Sbjct: 3 NDDLSNSCSPGDPLVLERPP 22 >SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -2 Query: 70 VPNSCSPGDPLVLERPP 20 V NSCSPGDPLVLERPP Sbjct: 19 VSNSCSPGDPLVLERPP 35 >SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -2 Query: 70 VPNSCSPGDPLVLERPP 20 V NSCSPGDPLVLERPP Sbjct: 4 VSNSCSPGDPLVLERPP 20 >SB_48029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 39.5 bits (88), Expect = 0.004 Identities = 15/20 (75%), Positives = 18/20 (90%) Frame = -2 Query: 79 SDLVPNSCSPGDPLVLERPP 20 +++ NSCSPGDPLVLERPP Sbjct: 11 ANITSNSCSPGDPLVLERPP 30 >SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -2 Query: 70 VPNSCSPGDPLVLERPP 20 V NSCSPGDPLVLERPP Sbjct: 25 VSNSCSPGDPLVLERPP 41 >SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 73 LVPNSCSPGDPLVLERPP 20 L NSCSPGDPLVLERPP Sbjct: 17 LASNSCSPGDPLVLERPP 34 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -2 Query: 79 SDLVPNSCSPGDPLVLERPP 20 S + NSCSPGDPLVLERPP Sbjct: 2419 SAIASNSCSPGDPLVLERPP 2438 >SB_44658| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -2 Query: 82 KSDLVPNSCSPGDPLVLERPP 20 K NSCSPGDPLVLERPP Sbjct: 9 KQQATSNSCSPGDPLVLERPP 29 >SB_43133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -2 Query: 70 VPNSCSPGDPLVLERPP 20 V NSCSPGDPLVLERPP Sbjct: 10 VSNSCSPGDPLVLERPP 26 >SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -2 Query: 70 VPNSCSPGDPLVLERPP 20 V NSCSPGDPLVLERPP Sbjct: 59 VSNSCSPGDPLVLERPP 75 >SB_42248| Best HMM Match : Keratin_B2 (HMM E-Value=4.4) Length = 736 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = -2 Query: 85 PKSDLVPNSCSPGDPLVLERPP 20 P + NSCSPGDPLVLERPP Sbjct: 607 PPVHFLSNSCSPGDPLVLERPP 628 >SB_40102| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -2 Query: 70 VPNSCSPGDPLVLERPP 20 V NSCSPGDPLVLERPP Sbjct: 31 VSNSCSPGDPLVLERPP 47 >SB_38659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -2 Query: 70 VPNSCSPGDPLVLERPP 20 V NSCSPGDPLVLERPP Sbjct: 4 VSNSCSPGDPLVLERPP 20 >SB_37939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -2 Query: 70 VPNSCSPGDPLVLERPP 20 V NSCSPGDPLVLERPP Sbjct: 15 VSNSCSPGDPLVLERPP 31 >SB_36967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -2 Query: 70 VPNSCSPGDPLVLERPP 20 V NSCSPGDPLVLERPP Sbjct: 4 VSNSCSPGDPLVLERPP 20 >SB_35822| Best HMM Match : DUF765 (HMM E-Value=3.3) Length = 138 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -2 Query: 70 VPNSCSPGDPLVLERPP 20 V NSCSPGDPLVLERPP Sbjct: 14 VSNSCSPGDPLVLERPP 30 >SB_35501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 39.5 bits (88), Expect = 0.004 Identities = 17/22 (77%), Positives = 17/22 (77%) Frame = -2 Query: 85 PKSDLVPNSCSPGDPLVLERPP 20 PK NSCSPGDPLVLERPP Sbjct: 12 PKRPHRSNSCSPGDPLVLERPP 33 >SB_34503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -2 Query: 70 VPNSCSPGDPLVLERPP 20 V NSCSPGDPLVLERPP Sbjct: 6 VSNSCSPGDPLVLERPP 22 >SB_32645| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -2 Query: 70 VPNSCSPGDPLVLERPP 20 V NSCSPGDPLVLERPP Sbjct: 15 VSNSCSPGDPLVLERPP 31 >SB_32565| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 73 LVPNSCSPGDPLVLERPP 20 L NSCSPGDPLVLERPP Sbjct: 37 LTSNSCSPGDPLVLERPP 54 >SB_32003| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -2 Query: 76 DLVPNSCSPGDPLVLERPP 20 D NSCSPGDPLVLERPP Sbjct: 10 DRTSNSCSPGDPLVLERPP 28 >SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -2 Query: 70 VPNSCSPGDPLVLERPP 20 V NSCSPGDPLVLERPP Sbjct: 18 VSNSCSPGDPLVLERPP 34 >SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 399 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 73 LVPNSCSPGDPLVLERPP 20 L NSCSPGDPLVLERPP Sbjct: 20 LASNSCSPGDPLVLERPP 37 >SB_28515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -2 Query: 70 VPNSCSPGDPLVLERPP 20 V NSCSPGDPLVLERPP Sbjct: 30 VSNSCSPGDPLVLERPP 46 >SB_25053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -2 Query: 70 VPNSCSPGDPLVLERPP 20 V NSCSPGDPLVLERPP Sbjct: 32 VSNSCSPGDPLVLERPP 48 >SB_23700| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -2 Query: 70 VPNSCSPGDPLVLERPP 20 V NSCSPGDPLVLERPP Sbjct: 10 VSNSCSPGDPLVLERPP 26 >SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -2 Query: 70 VPNSCSPGDPLVLERPP 20 V NSCSPGDPLVLERPP Sbjct: 17 VSNSCSPGDPLVLERPP 33 >SB_21702| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -2 Query: 70 VPNSCSPGDPLVLERPP 20 V NSCSPGDPLVLERPP Sbjct: 14 VSNSCSPGDPLVLERPP 30 >SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -2 Query: 70 VPNSCSPGDPLVLERPP 20 V NSCSPGDPLVLERPP Sbjct: 34 VSNSCSPGDPLVLERPP 50 >SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 73 LVPNSCSPGDPLVLERPP 20 L NSCSPGDPLVLERPP Sbjct: 11 LASNSCSPGDPLVLERPP 28 >SB_19132| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 39.5 bits (88), Expect = 0.004 Identities = 17/23 (73%), Positives = 17/23 (73%) Frame = -2 Query: 88 TPKSDLVPNSCSPGDPLVLERPP 20 T K NSCSPGDPLVLERPP Sbjct: 12 TSKHKAKSNSCSPGDPLVLERPP 34 >SB_14766| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -2 Query: 70 VPNSCSPGDPLVLERPP 20 V NSCSPGDPLVLERPP Sbjct: 10 VSNSCSPGDPLVLERPP 26 >SB_14435| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 234 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = -2 Query: 85 PKSDLVPNSCSPGDPLVLERPP 20 P + NSCSPGDPLVLERPP Sbjct: 105 PFNGFTSNSCSPGDPLVLERPP 126 >SB_14039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -2 Query: 70 VPNSCSPGDPLVLERPP 20 V NSCSPGDPLVLERPP Sbjct: 18 VSNSCSPGDPLVLERPP 34 >SB_13084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 73 LVPNSCSPGDPLVLERPP 20 L NSCSPGDPLVLERPP Sbjct: 11 LASNSCSPGDPLVLERPP 28 >SB_12674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 73 LVPNSCSPGDPLVLERPP 20 L NSCSPGDPLVLERPP Sbjct: 3 LASNSCSPGDPLVLERPP 20 >SB_12453| Best HMM Match : DUF765 (HMM E-Value=5) Length = 140 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 73 LVPNSCSPGDPLVLERPP 20 L NSCSPGDPLVLERPP Sbjct: 15 LTSNSCSPGDPLVLERPP 32 >SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) Length = 1101 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 73 LVPNSCSPGDPLVLERPP 20 L NSCSPGDPLVLERPP Sbjct: 661 LASNSCSPGDPLVLERPP 678 >SB_9111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -2 Query: 70 VPNSCSPGDPLVLERPP 20 V NSCSPGDPLVLERPP Sbjct: 27 VSNSCSPGDPLVLERPP 43 >SB_9069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 73 LVPNSCSPGDPLVLERPP 20 L NSCSPGDPLVLERPP Sbjct: 7 LASNSCSPGDPLVLERPP 24 >SB_8550| Best HMM Match : MASE1 (HMM E-Value=1.5) Length = 317 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -2 Query: 70 VPNSCSPGDPLVLERPP 20 V NSCSPGDPLVLERPP Sbjct: 193 VSNSCSPGDPLVLERPP 209 >SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 39.5 bits (88), Expect = 0.004 Identities = 15/18 (83%), Positives = 17/18 (94%) Frame = -2 Query: 73 LVPNSCSPGDPLVLERPP 20 ++ NSCSPGDPLVLERPP Sbjct: 25 VISNSCSPGDPLVLERPP 42 >SB_3293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 39.5 bits (88), Expect = 0.004 Identities = 17/23 (73%), Positives = 19/23 (82%), Gaps = 1/23 (4%) Frame = -2 Query: 85 PKSDLV-PNSCSPGDPLVLERPP 20 PK + + NSCSPGDPLVLERPP Sbjct: 29 PKQESIRSNSCSPGDPLVLERPP 51 >SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 73 LVPNSCSPGDPLVLERPP 20 L NSCSPGDPLVLERPP Sbjct: 4 LASNSCSPGDPLVLERPP 21 >SB_516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -2 Query: 70 VPNSCSPGDPLVLERPP 20 V NSCSPGDPLVLERPP Sbjct: 10 VSNSCSPGDPLVLERPP 26 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 39.1 bits (87), Expect = 0.005 Identities = 15/21 (71%), Positives = 18/21 (85%) Frame = -2 Query: 82 KSDLVPNSCSPGDPLVLERPP 20 + + + NSCSPGDPLVLERPP Sbjct: 30 RMEYLSNSCSPGDPLVLERPP 50 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/26 (73%), Positives = 20/26 (76%), Gaps = 3/26 (11%) Frame = -2 Query: 88 TPKSDLVP---NSCSPGDPLVLERPP 20 T + LVP NSCSPGDPLVLERPP Sbjct: 17 TNGASLVPRPSNSCSPGDPLVLERPP 42 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 39.1 bits (87), Expect = 0.005 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 70 VPNSCSPGDPLVLERPP 20 + NSCSPGDPLVLERPP Sbjct: 5 ISNSCSPGDPLVLERPP 21 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 39.1 bits (87), Expect = 0.005 Identities = 16/21 (76%), Positives = 17/21 (80%) Frame = -2 Query: 82 KSDLVPNSCSPGDPLVLERPP 20 +S NSCSPGDPLVLERPP Sbjct: 19 RSKRASNSCSPGDPLVLERPP 39 >SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 39.1 bits (87), Expect = 0.005 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 70 VPNSCSPGDPLVLERPP 20 + NSCSPGDPLVLERPP Sbjct: 16 ISNSCSPGDPLVLERPP 32 >SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 236 Score = 39.1 bits (87), Expect = 0.005 Identities = 16/21 (76%), Positives = 17/21 (80%) Frame = -2 Query: 82 KSDLVPNSCSPGDPLVLERPP 20 K + NSCSPGDPLVLERPP Sbjct: 108 KRSVESNSCSPGDPLVLERPP 128 >SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 39.1 bits (87), Expect = 0.005 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = -2 Query: 79 SDLVPNSCSPGDPLVLERPP 20 S NSCSPGDPLVLERPP Sbjct: 17 SQTASNSCSPGDPLVLERPP 36 >SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 39.1 bits (87), Expect = 0.005 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 70 VPNSCSPGDPLVLERPP 20 + NSCSPGDPLVLERPP Sbjct: 59 ISNSCSPGDPLVLERPP 75 >SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 39.1 bits (87), Expect = 0.005 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 70 VPNSCSPGDPLVLERPP 20 + NSCSPGDPLVLERPP Sbjct: 9 ISNSCSPGDPLVLERPP 25 >SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 39.1 bits (87), Expect = 0.005 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 70 VPNSCSPGDPLVLERPP 20 + NSCSPGDPLVLERPP Sbjct: 10 ISNSCSPGDPLVLERPP 26 >SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 39.1 bits (87), Expect = 0.005 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 70 VPNSCSPGDPLVLERPP 20 + NSCSPGDPLVLERPP Sbjct: 3 ISNSCSPGDPLVLERPP 19 >SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 39.1 bits (87), Expect = 0.005 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 70 VPNSCSPGDPLVLERPP 20 + NSCSPGDPLVLERPP Sbjct: 13 ISNSCSPGDPLVLERPP 29 >SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 39.1 bits (87), Expect = 0.005 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 70 VPNSCSPGDPLVLERPP 20 + NSCSPGDPLVLERPP Sbjct: 4 ISNSCSPGDPLVLERPP 20 >SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) Length = 176 Score = 39.1 bits (87), Expect = 0.005 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 70 VPNSCSPGDPLVLERPP 20 + NSCSPGDPLVLERPP Sbjct: 52 ISNSCSPGDPLVLERPP 68 >SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 39.1 bits (87), Expect = 0.005 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 70 VPNSCSPGDPLVLERPP 20 + NSCSPGDPLVLERPP Sbjct: 51 ISNSCSPGDPLVLERPP 67 >SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) Length = 128 Score = 39.1 bits (87), Expect = 0.005 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -2 Query: 79 SDLVPNSCSPGDPLVLERPP 20 + L NSCSPGDPLVLERPP Sbjct: 2 TSLSSNSCSPGDPLVLERPP 21 >SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 39.1 bits (87), Expect = 0.005 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 70 VPNSCSPGDPLVLERPP 20 + NSCSPGDPLVLERPP Sbjct: 16 ISNSCSPGDPLVLERPP 32 >SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 39.1 bits (87), Expect = 0.005 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 70 VPNSCSPGDPLVLERPP 20 + NSCSPGDPLVLERPP Sbjct: 21 ISNSCSPGDPLVLERPP 37 >SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 276 Score = 39.1 bits (87), Expect = 0.005 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 70 VPNSCSPGDPLVLERPP 20 + NSCSPGDPLVLERPP Sbjct: 152 ISNSCSPGDPLVLERPP 168 >SB_57030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 39.1 bits (87), Expect = 0.005 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = -2 Query: 82 KSDLVPNSCSPGDPLVLERPP 20 ++ L NSCSPGDPLVLERPP Sbjct: 3 QTGLPSNSCSPGDPLVLERPP 23 >SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 39.1 bits (87), Expect = 0.005 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 70 VPNSCSPGDPLVLERPP 20 + NSCSPGDPLVLERPP Sbjct: 4 ISNSCSPGDPLVLERPP 20 >SB_53325| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 39.1 bits (87), Expect = 0.005 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 70 VPNSCSPGDPLVLERPP 20 + NSCSPGDPLVLERPP Sbjct: 4 ISNSCSPGDPLVLERPP 20 >SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 39.1 bits (87), Expect = 0.005 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 70 VPNSCSPGDPLVLERPP 20 + NSCSPGDPLVLERPP Sbjct: 32 ISNSCSPGDPLVLERPP 48 >SB_49519| Best HMM Match : DUF1378 (HMM E-Value=8.8) Length = 213 Score = 39.1 bits (87), Expect = 0.005 Identities = 25/52 (48%), Positives = 26/52 (50%) Frame = -2 Query: 175 GSKLSASHDTSIFRTPESAAELI*KLFT*TPKSDLVPNSCSPGDPLVLERPP 20 GS L DT F P+S T S NSCSPGDPLVLERPP Sbjct: 84 GSFLQIIGDT--FGLPKSTVSRCVSDVTRALVSKAESNSCSPGDPLVLERPP 133 >SB_48240| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 39.1 bits (87), Expect = 0.005 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = -2 Query: 85 PKSDLVPNSCSPGDPLVLERPP 20 P+ NSCSPGDPLVLERPP Sbjct: 3 PEGSHPSNSCSPGDPLVLERPP 24 >SB_47825| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 39.1 bits (87), Expect = 0.005 Identities = 15/19 (78%), Positives = 17/19 (89%) Frame = -2 Query: 76 DLVPNSCSPGDPLVLERPP 20 ++ NSCSPGDPLVLERPP Sbjct: 21 EVTSNSCSPGDPLVLERPP 39 >SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 39.1 bits (87), Expect = 0.005 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 70 VPNSCSPGDPLVLERPP 20 + NSCSPGDPLVLERPP Sbjct: 18 ISNSCSPGDPLVLERPP 34 >SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 39.1 bits (87), Expect = 0.005 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 70 VPNSCSPGDPLVLERPP 20 + NSCSPGDPLVLERPP Sbjct: 32 ISNSCSPGDPLVLERPP 48 >SB_43874| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 39.1 bits (87), Expect = 0.005 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 70 VPNSCSPGDPLVLERPP 20 + NSCSPGDPLVLERPP Sbjct: 6 ISNSCSPGDPLVLERPP 22 >SB_43538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 39.1 bits (87), Expect = 0.005 Identities = 21/31 (67%), Positives = 22/31 (70%), Gaps = 3/31 (9%) Frame = -2 Query: 103 KLFT*TPKSDLVP---NSCSPGDPLVLERPP 20 K FT T S +P NSCSPGDPLVLERPP Sbjct: 2 KHFTDTLISANIPKRSNSCSPGDPLVLERPP 32 >SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) Length = 190 Score = 39.1 bits (87), Expect = 0.005 Identities = 15/18 (83%), Positives = 17/18 (94%) Frame = -2 Query: 73 LVPNSCSPGDPLVLERPP 20 ++ NSCSPGDPLVLERPP Sbjct: 65 MLSNSCSPGDPLVLERPP 82 >SB_39977| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 39.1 bits (87), Expect = 0.005 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -2 Query: 79 SDLVPNSCSPGDPLVLERPP 20 S + NSCSPGDPLVLERPP Sbjct: 2 SSIGSNSCSPGDPLVLERPP 21 >SB_39278| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 39.1 bits (87), Expect = 0.005 Identities = 16/23 (69%), Positives = 17/23 (73%) Frame = -2 Query: 88 TPKSDLVPNSCSPGDPLVLERPP 20 +P NSCSPGDPLVLERPP Sbjct: 4 SPLESYPSNSCSPGDPLVLERPP 26 >SB_37610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 39.1 bits (87), Expect = 0.005 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 70 VPNSCSPGDPLVLERPP 20 + NSCSPGDPLVLERPP Sbjct: 1 ISNSCSPGDPLVLERPP 17 >SB_37411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 39.1 bits (87), Expect = 0.005 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 70 VPNSCSPGDPLVLERPP 20 + NSCSPGDPLVLERPP Sbjct: 5 ISNSCSPGDPLVLERPP 21 >SB_33166| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 39.1 bits (87), Expect = 0.005 Identities = 18/26 (69%), Positives = 20/26 (76%), Gaps = 3/26 (11%) Frame = -2 Query: 88 TPKSDLVP---NSCSPGDPLVLERPP 20 TP ++P NSCSPGDPLVLERPP Sbjct: 50 TPVVGMLPRRSNSCSPGDPLVLERPP 75 >SB_30165| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 39.1 bits (87), Expect = 0.005 Identities = 15/21 (71%), Positives = 18/21 (85%) Frame = -2 Query: 82 KSDLVPNSCSPGDPLVLERPP 20 + ++ NSCSPGDPLVLERPP Sbjct: 4 RHNVTSNSCSPGDPLVLERPP 24 >SB_29275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 240 Score = 39.1 bits (87), Expect = 0.005 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 70 VPNSCSPGDPLVLERPP 20 + NSCSPGDPLVLERPP Sbjct: 116 ISNSCSPGDPLVLERPP 132 >SB_27295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 39.1 bits (87), Expect = 0.005 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 70 VPNSCSPGDPLVLERPP 20 + NSCSPGDPLVLERPP Sbjct: 2 ISNSCSPGDPLVLERPP 18 >SB_27058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 39.1 bits (87), Expect = 0.005 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 70 VPNSCSPGDPLVLERPP 20 + NSCSPGDPLVLERPP Sbjct: 2 ISNSCSPGDPLVLERPP 18 >SB_26956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 39.1 bits (87), Expect = 0.005 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 70 VPNSCSPGDPLVLERPP 20 + NSCSPGDPLVLERPP Sbjct: 14 ISNSCSPGDPLVLERPP 30 >SB_26923| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 39.1 bits (87), Expect = 0.005 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 70 VPNSCSPGDPLVLERPP 20 + NSCSPGDPLVLERPP Sbjct: 2 ISNSCSPGDPLVLERPP 18 >SB_26694| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 39.1 bits (87), Expect = 0.005 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 70 VPNSCSPGDPLVLERPP 20 + NSCSPGDPLVLERPP Sbjct: 8 ISNSCSPGDPLVLERPP 24 >SB_21311| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 39.1 bits (87), Expect = 0.005 Identities = 17/28 (60%), Positives = 19/28 (67%) Frame = -2 Query: 103 KLFT*TPKSDLVPNSCSPGDPLVLERPP 20 K++T NSCSPGDPLVLERPP Sbjct: 8 KIYTLDHTERRASNSCSPGDPLVLERPP 35 >SB_20053| Best HMM Match : DUF765 (HMM E-Value=3.9) Length = 134 Score = 39.1 bits (87), Expect = 0.005 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -2 Query: 79 SDLVPNSCSPGDPLVLERPP 20 + + NSCSPGDPLVLERPP Sbjct: 7 AQITSNSCSPGDPLVLERPP 26 >SB_18140| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 39.1 bits (87), Expect = 0.005 Identities = 21/54 (38%), Positives = 32/54 (59%), Gaps = 3/54 (5%) Frame = +3 Query: 21 GGRSRTSGSPGLQEFGTRSDFGVQVK--SFHINSAADSGVLKMDVSWDA-DNFE 173 GGRSRTSGSPGLQEF + G + + ++H + G +++ + D+FE Sbjct: 9 GGRSRTSGSPGLQEFDVKHHQGTRDRTITYHSRGKHNQGTRDRTMTYHSRDDFE 62 >SB_17821| Best HMM Match : PQ-loop (HMM E-Value=6.7) Length = 176 Score = 39.1 bits (87), Expect = 0.005 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 70 VPNSCSPGDPLVLERPP 20 + NSCSPGDPLVLERPP Sbjct: 52 ISNSCSPGDPLVLERPP 68 >SB_17198| Best HMM Match : HEAT (HMM E-Value=1.8e-15) Length = 802 Score = 39.1 bits (87), Expect = 0.005 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 70 VPNSCSPGDPLVLERPP 20 + NSCSPGDPLVLERPP Sbjct: 90 ISNSCSPGDPLVLERPP 106 >SB_17162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 229 Score = 39.1 bits (87), Expect = 0.005 Identities = 15/18 (83%), Positives = 17/18 (94%) Frame = -2 Query: 73 LVPNSCSPGDPLVLERPP 20 ++ NSCSPGDPLVLERPP Sbjct: 104 ILSNSCSPGDPLVLERPP 121 >SB_13387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 39.1 bits (87), Expect = 0.005 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 70 VPNSCSPGDPLVLERPP 20 + NSCSPGDPLVLERPP Sbjct: 7 ISNSCSPGDPLVLERPP 23 >SB_12908| Best HMM Match : Drf_FH1 (HMM E-Value=4.9) Length = 283 Score = 39.1 bits (87), Expect = 0.005 Identities = 16/21 (76%), Positives = 17/21 (80%) Frame = -2 Query: 82 KSDLVPNSCSPGDPLVLERPP 20 K + NSCSPGDPLVLERPP Sbjct: 155 KQWIASNSCSPGDPLVLERPP 175 >SB_11350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 39.1 bits (87), Expect = 0.005 Identities = 16/23 (69%), Positives = 17/23 (73%) Frame = -2 Query: 88 TPKSDLVPNSCSPGDPLVLERPP 20 +P NSCSPGDPLVLERPP Sbjct: 18 SPPPVFTSNSCSPGDPLVLERPP 40 >SB_9296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 39.1 bits (87), Expect = 0.005 Identities = 15/18 (83%), Positives = 17/18 (94%) Frame = -2 Query: 73 LVPNSCSPGDPLVLERPP 20 ++ NSCSPGDPLVLERPP Sbjct: 12 ILSNSCSPGDPLVLERPP 29 >SB_9153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 39.1 bits (87), Expect = 0.005 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 70 VPNSCSPGDPLVLERPP 20 + NSCSPGDPLVLERPP Sbjct: 6 ISNSCSPGDPLVLERPP 22 >SB_8232| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 192 Score = 39.1 bits (87), Expect = 0.005 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 70 VPNSCSPGDPLVLERPP 20 + NSCSPGDPLVLERPP Sbjct: 68 ISNSCSPGDPLVLERPP 84 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,853,814 Number of Sequences: 59808 Number of extensions: 429111 Number of successful extensions: 3263 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 3203 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3263 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2872045441 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -