BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30819 (971 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ549085-1|CAD70159.1| 529|Anopheles gambiae thioredoxin-disulf... 27 1.1 AJ549084-1|CAD70158.1| 505|Anopheles gambiae thioredoxin-disulf... 27 1.1 AJ459821-1|CAD30858.1| 502|Anopheles gambiae thioredoxin reduct... 27 1.1 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 25 4.5 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 25 4.5 >AJ549085-1|CAD70159.1| 529|Anopheles gambiae thioredoxin-disulfide reductase protein. Length = 529 Score = 26.6 bits (56), Expect = 1.1 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +3 Query: 15 AVGGRSRTSGSPGLQEFGTRSD 80 AVGGR R PG E+G SD Sbjct: 187 AVGGRPRYPDIPGAAEYGITSD 208 >AJ549084-1|CAD70158.1| 505|Anopheles gambiae thioredoxin-disulfide reductase protein. Length = 505 Score = 26.6 bits (56), Expect = 1.1 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +3 Query: 15 AVGGRSRTSGSPGLQEFGTRSD 80 AVGGR R PG E+G SD Sbjct: 163 AVGGRPRYPDIPGAAEYGITSD 184 >AJ459821-1|CAD30858.1| 502|Anopheles gambiae thioredoxin reductase protein. Length = 502 Score = 26.6 bits (56), Expect = 1.1 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +3 Query: 15 AVGGRSRTSGSPGLQEFGTRSD 80 AVGGR R PG E+G SD Sbjct: 160 AVGGRPRYPDIPGAAEYGITSD 181 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 24.6 bits (51), Expect = 4.5 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +2 Query: 737 RLIKLKKGHXGARARAKF 790 +L+KLK H G RAKF Sbjct: 2148 KLLKLKPSHLGTGRRAKF 2165 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 24.6 bits (51), Expect = 4.5 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +2 Query: 737 RLIKLKKGHXGARARAKF 790 +L+KLK H G RAKF Sbjct: 2149 KLLKLKPSHLGTGRRAKF 2166 Score = 24.2 bits (50), Expect = 6.0 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = +1 Query: 502 NRSNIGKLDNFHPTTKEEYTEFADLLTKKITFY 600 NR++ LDN KE++ F + TFY Sbjct: 3221 NRNSGNWLDNIFKDIKEDFNVFLSTVNPSRTFY 3253 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 793,405 Number of Sequences: 2352 Number of extensions: 12836 Number of successful extensions: 20 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 65 effective length of database: 411,099 effective search space used: 106063542 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -