BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30818 (758 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 25 0.87 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 25 0.87 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 25 0.87 AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory recept... 25 0.87 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 25 0.87 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 25 0.87 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 25 0.87 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 25 0.87 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 25 0.87 EU019711-1|ABU25223.1| 534|Tribolium castaneum chitin deacetyla... 22 4.6 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 24.6 bits (51), Expect = 0.87 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = -1 Query: 698 TQTS*NEKAGVNNNINKS 645 + TS EKAG NNN +KS Sbjct: 174 SSTSSTEKAGTNNNNSKS 191 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 24.6 bits (51), Expect = 0.87 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = -1 Query: 698 TQTS*NEKAGVNNNINKS 645 + TS EKAG NNN +KS Sbjct: 174 SSTSSTEKAGTNNNNSKS 191 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 24.6 bits (51), Expect = 0.87 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = -1 Query: 698 TQTS*NEKAGVNNNINKS 645 + TS EKAG NNN +KS Sbjct: 174 SSTSSTEKAGTNNNNSKS 191 >AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory receptor candidate 1 protein. Length = 373 Score = 24.6 bits (51), Expect = 0.87 Identities = 16/40 (40%), Positives = 22/40 (55%), Gaps = 3/40 (7%) Frame = -3 Query: 153 CELNAQQTLLATHALWIVGQ---IVFLVSFLIITTVTFLL 43 C L+ + L T I G ++F VSFLIIT V F++ Sbjct: 223 CTLHHHLSKLVTRFNEIFGLGLLLMFAVSFLIITQVIFVI 262 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 24.6 bits (51), Expect = 0.87 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = -1 Query: 698 TQTS*NEKAGVNNNINKS 645 + TS EKAG NNN +KS Sbjct: 174 SSTSSTEKAGTNNNNSKS 191 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 24.6 bits (51), Expect = 0.87 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = -1 Query: 698 TQTS*NEKAGVNNNINKS 645 + TS EKAG NNN +KS Sbjct: 174 SSTSSTEKAGTNNNNSKS 191 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 24.6 bits (51), Expect = 0.87 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = -1 Query: 698 TQTS*NEKAGVNNNINKS 645 + TS EKAG NNN +KS Sbjct: 130 SSTSSTEKAGTNNNNSKS 147 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 24.6 bits (51), Expect = 0.87 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = -1 Query: 698 TQTS*NEKAGVNNNINKS 645 + TS EKAG NNN +KS Sbjct: 174 SSTSSTEKAGTNNNNSKS 191 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 24.6 bits (51), Expect = 0.87 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = -1 Query: 698 TQTS*NEKAGVNNNINKS 645 + TS EKAG NNN +KS Sbjct: 174 SSTSSTEKAGTNNNNSKS 191 >EU019711-1|ABU25223.1| 534|Tribolium castaneum chitin deacetylase 1 protein. Length = 534 Score = 22.2 bits (45), Expect = 4.6 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -2 Query: 79 QFPHHHHGHLPSCVPT 32 + PH HG+L SC PT Sbjct: 344 RMPHRCHGNLQSC-PT 358 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 151,089 Number of Sequences: 336 Number of extensions: 2807 Number of successful extensions: 15 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20338724 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -