BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30818 (758 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855486-1|ABH88173.1| 104|Apis mellifera chemosensory protein ... 23 2.4 AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 23 3.1 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 22 5.4 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 21 9.5 >DQ855486-1|ABH88173.1| 104|Apis mellifera chemosensory protein 5 protein. Length = 104 Score = 23.4 bits (48), Expect = 2.4 Identities = 11/36 (30%), Positives = 16/36 (44%) Frame = -2 Query: 571 KQERIFPPLVPFHRNMSIPRQVASYNQLTKFRANNY 464 K + + P ++ H N RQ+ N L F NY Sbjct: 52 KIKELLPEVLNNHCNRCTSRQIGIANTLIPFMQQNY 87 Score = 22.6 bits (46), Expect = 4.1 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +2 Query: 419 YIYKSVYCITLKSVYVVIGSKFCELI 496 Y+ K ++CI + VIG K EL+ Sbjct: 32 YVQKQLHCILDRGHCDVIGKKIKELL 57 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 23.0 bits (47), Expect = 3.1 Identities = 6/7 (85%), Positives = 6/7 (85%) Frame = -2 Query: 73 PHHHHGH 53 PHHHH H Sbjct: 430 PHHHHSH 436 Score = 21.4 bits (43), Expect = 9.5 Identities = 11/31 (35%), Positives = 12/31 (38%) Frame = -2 Query: 139 PTNASGDPRAVDSRPDRIPRQFPHHHHGHLP 47 P + P A S P I HHH H P Sbjct: 440 PHHQHSTPLAHSSYPAAIQIGHTPHHHPHPP 470 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 22.2 bits (45), Expect = 5.4 Identities = 6/7 (85%), Positives = 6/7 (85%) Frame = -2 Query: 73 PHHHHGH 53 PHHHH H Sbjct: 350 PHHHHHH 356 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 21.4 bits (43), Expect = 9.5 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = +1 Query: 274 HHVNPPKSTTARISPLSA 327 HHV PP A +PL A Sbjct: 511 HHVAPPSGHHASSAPLLA 528 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 179,365 Number of Sequences: 438 Number of extensions: 3288 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23875740 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -