BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30816 (449 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81522-5|CAD98731.1| 663|Caenorhabditis elegans Hypothetical pr... 27 8.3 Z81522-4|CAB04233.1| 771|Caenorhabditis elegans Hypothetical pr... 27 8.3 >Z81522-5|CAD98731.1| 663|Caenorhabditis elegans Hypothetical protein F32B4.4b protein. Length = 663 Score = 26.6 bits (56), Expect = 8.3 Identities = 14/46 (30%), Positives = 23/46 (50%) Frame = -1 Query: 248 DSVTAPRACSAEGLASLRVAVYCNKHSRAALRSQGKTPGM*TQPVT 111 + + AP + S+EG + R A+ SR+ R G P +P+T Sbjct: 119 EPIHAPESSSSEGQRAKRRAIEAPVRSRSRSRGGGGEPRSSRKPIT 164 >Z81522-4|CAB04233.1| 771|Caenorhabditis elegans Hypothetical protein F32B4.4a protein. Length = 771 Score = 26.6 bits (56), Expect = 8.3 Identities = 14/46 (30%), Positives = 23/46 (50%) Frame = -1 Query: 248 DSVTAPRACSAEGLASLRVAVYCNKHSRAALRSQGKTPGM*TQPVT 111 + + AP + S+EG + R A+ SR+ R G P +P+T Sbjct: 227 EPIHAPESSSSEGQRAKRRAIEAPVRSRSRSRGGGGEPRSSRKPIT 272 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,568,670 Number of Sequences: 27780 Number of extensions: 146176 Number of successful extensions: 308 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 304 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 308 length of database: 12,740,198 effective HSP length: 75 effective length of database: 10,656,698 effective search space used: 788595652 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -