BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30807 (771 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxy... 27 0.13 AJ850297-1|CAH64517.1| 539|Tribolium castaneum putative esteras... 23 2.0 AJ850295-1|CAH64515.1| 539|Tribolium castaneum putative esteras... 23 2.0 AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory recept... 22 6.2 AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 21 8.2 >EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxylase protein. Length = 532 Score = 27.5 bits (58), Expect = 0.13 Identities = 14/43 (32%), Positives = 22/43 (51%) Frame = +1 Query: 46 KKHILLMSFIGKDNKPAPKLRDIILRSDKWHSVYNEVVESMHK 174 +K I ++F K P P ++ + W SV+N V+E M K Sbjct: 233 RKEIAEIAFAYKYGDPIPYIQYTETETKTWGSVFNTVLELMPK 275 >AJ850297-1|CAH64517.1| 539|Tribolium castaneum putative esterase protein. Length = 539 Score = 23.4 bits (48), Expect = 2.0 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = +1 Query: 397 ALMKLM*TYWKEFIPHTILWH 459 AL+ L+ YW E+IP + ++ Sbjct: 335 ALLALLDDYWNEYIPPILYYN 355 >AJ850295-1|CAH64515.1| 539|Tribolium castaneum putative esterase protein. Length = 539 Score = 23.4 bits (48), Expect = 2.0 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = +1 Query: 397 ALMKLM*TYWKEFIPHTILWH 459 AL+ L+ YW E+IP + ++ Sbjct: 335 ALLALLDDYWNEYIPPILYYN 355 >AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory receptor candidate 51 protein. Length = 771 Score = 21.8 bits (44), Expect = 6.2 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = -1 Query: 690 LLEVNFHWSILDFITKNWAATIKQFYFWQ 604 L+ + W + F +N + +KQF F Q Sbjct: 443 LIALKLVWIVALFKNENLSEMVKQFLFTQ 471 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 21.4 bits (43), Expect = 8.2 Identities = 9/23 (39%), Positives = 16/23 (69%) Frame = -2 Query: 302 KLQPVRVVRLHRLRNIINQHLLS 234 K+QP+R +++ RNI N ++ S Sbjct: 560 KMQPLRTLKIGVYRNIKNFNIPS 582 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 185,918 Number of Sequences: 336 Number of extensions: 4365 Number of successful extensions: 11 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20753800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -