BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30806 (834 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855484-1|ABH88171.1| 130|Apis mellifera chemosensory protein ... 25 0.86 AF481963-1|AAN59784.1| 130|Apis mellifera antennal-specific pro... 25 0.86 AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 24 1.5 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 24 2.0 AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 22 6.1 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 22 6.1 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 22 6.1 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 22 8.0 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 22 8.0 >DQ855484-1|ABH88171.1| 130|Apis mellifera chemosensory protein 3 protein. Length = 130 Score = 25.0 bits (52), Expect = 0.86 Identities = 16/56 (28%), Positives = 27/56 (48%), Gaps = 8/56 (14%) Frame = +1 Query: 211 ECRRCP-----TVIMACHFLIEQKTE---GSERKQQMAKEYRVKVEKELREICYDV 354 +C++C + FL+E K E K K+YRVK E+E +++ +V Sbjct: 75 DCKKCTDKQREVIKKVIKFLVENKPELWDSLANKYDPDKKYRVKFEEEAKKLGINV 130 >AF481963-1|AAN59784.1| 130|Apis mellifera antennal-specific protein 3c precursor protein. Length = 130 Score = 25.0 bits (52), Expect = 0.86 Identities = 16/56 (28%), Positives = 27/56 (48%), Gaps = 8/56 (14%) Frame = +1 Query: 211 ECRRCP-----TVIMACHFLIEQKTE---GSERKQQMAKEYRVKVEKELREICYDV 354 +C++C + FL+E K E K K+YRVK E+E +++ +V Sbjct: 75 DCKKCTDKQREVIKKVIKFLVENKPELWDSLANKYDPDKKYRVKFEEEAKKLGINV 130 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 24.2 bits (50), Expect = 1.5 Identities = 10/34 (29%), Positives = 16/34 (47%) Frame = -3 Query: 226 GTYDILISN*KEVPLLVAKFDAGFRDFLHRGRHV 125 G +D+ + + + V L A F HRG H+ Sbjct: 183 GAFDVTLESGERVTFLDTPGHAAFISMRHRGAHI 216 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 23.8 bits (49), Expect = 2.0 Identities = 11/38 (28%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = -3 Query: 613 NLISHN-KRTEKFNARPSLMGCVGCIFALLISKASWML 503 N H+ KR + R L+ C G +F ++ WM+ Sbjct: 751 NASKHSAKRPSFISPRSQLIICSGLVFVQILINGVWMI 788 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 22.2 bits (45), Expect = 6.1 Identities = 13/63 (20%), Positives = 32/63 (50%) Frame = +1 Query: 259 EQKTEGSERKQQMAKEYRVKVEKELREICYDVLGLLDKHLIPKASNPESKVFYLKMKGDY 438 E++T +E+ +M K Y ++KE +++ ++ + + A ++ + K K D+ Sbjct: 441 EKRTIENEQLNRMYKSYPNYIDKETKDMNLEISTRPKSNTVENACVLKNTEIF-KDKSDW 499 Query: 439 YRY 447 + Y Sbjct: 500 FDY 502 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 22.2 bits (45), Expect = 6.1 Identities = 11/49 (22%), Positives = 22/49 (44%) Frame = +2 Query: 671 GTGHIERRFVTKILR*IMAVAAEDNLNAFWTSEHSKGDWRTEPFPKGGG 817 G+G + +T+ + + ++ ED A TS+ + W+ P G Sbjct: 1094 GSGPLSEPLLTQTMEDVPSIPPEDVRCAALTSQSLQVSWQPPPNTHSNG 1142 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 22.2 bits (45), Expect = 6.1 Identities = 11/49 (22%), Positives = 22/49 (44%) Frame = +2 Query: 671 GTGHIERRFVTKILR*IMAVAAEDNLNAFWTSEHSKGDWRTEPFPKGGG 817 G+G + +T+ + + ++ ED A TS+ + W+ P G Sbjct: 1090 GSGPLSEPLLTQTMEDVPSIPPEDVRCAALTSQSLQVSWQPPPNTHSNG 1138 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 21.8 bits (44), Expect = 8.0 Identities = 7/34 (20%), Positives = 17/34 (50%) Frame = -3 Query: 622 CLANLISHNKRTEKFNARPSLMGCVGCIFALLIS 521 C I+H + F P+++ C+G + + ++ Sbjct: 501 CYQLAINHIRWNSAFAIAPAVISCLGIVATMAVA 534 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 21.8 bits (44), Expect = 8.0 Identities = 7/34 (20%), Positives = 17/34 (50%) Frame = -3 Query: 622 CLANLISHNKRTEKFNARPSLMGCVGCIFALLIS 521 C I+H + F P+++ C+G + + ++ Sbjct: 591 CYQLAINHIRWNSAFAIAPAVISCLGIVATMAVA 624 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 236,981 Number of Sequences: 438 Number of extensions: 4865 Number of successful extensions: 14 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 26702940 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -