BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30801 (745 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222290-1|ABN79650.1| 378|Tribolium castaneum adipokinetic hor... 24 1.5 DQ422965-1|ABE02225.1| 378|Tribolium castaneum adipokinetic hor... 24 1.5 AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nu... 24 1.5 >EF222290-1|ABN79650.1| 378|Tribolium castaneum adipokinetic hormone receptor protein. Length = 378 Score = 23.8 bits (49), Expect = 1.5 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = -3 Query: 443 RRMRGWPSRLNTTLL-LAPMTVAVVFRHRQIRISCWYSNV 327 +R R PSR+NT L+ LA + V F + I W S V Sbjct: 79 KRRRKTPSRINTMLMHLAIADLLVTFLMMPLEIG-WASTV 117 >DQ422965-1|ABE02225.1| 378|Tribolium castaneum adipokinetic hormone receptor protein. Length = 378 Score = 23.8 bits (49), Expect = 1.5 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = -3 Query: 443 RRMRGWPSRLNTTLL-LAPMTVAVVFRHRQIRISCWYSNV 327 +R R PSR+NT L+ LA + V F + I W S V Sbjct: 79 KRRRKTPSRINTMLMHLAIADLLVTFLMMPLEIG-WASTV 117 >AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nuclear receptor protein. Length = 407 Score = 23.8 bits (49), Expect = 1.5 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = +1 Query: 100 IQTNPETSRLRSKRRVFGVTEEQGQTHHQNKTRR 201 I++ E LR K ++GV EE +T H N+ R Sbjct: 329 IKSVQEVEMLREK--IYGVLEEYTRTTHPNEPGR 360 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 159,717 Number of Sequences: 336 Number of extensions: 3276 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 19819879 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -