BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30801 (745 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC23C4.15 |rpb5||DNA-directed RNA polymerase I, II and III sub... 25 8.6 SPAPB15E9.01c ||SPAPB18E9.06c|sequence orphan|Schizosaccharomyce... 25 8.6 >SPAC23C4.15 |rpb5||DNA-directed RNA polymerase I, II and III subunit Rpb5 |Schizosaccharomyces pombe|chr 1|||Manual Length = 210 Score = 25.4 bits (53), Expect = 8.6 Identities = 21/73 (28%), Positives = 32/73 (43%), Gaps = 2/73 (2%) Frame = +2 Query: 77 DREIDSARYKQIPKHHDYVLNE--EYLASQKNRAKLITRIRPDEPVVADNVILESNVVKI 250 D ++ ++ +PKH +E E L K R + RI+ +PV + VVKI Sbjct: 134 DLIVNITHHELVPKHILLSPDEKKELLDRYKLRETQLPRIQLADPVARYLGLKRGEVVKI 193 Query: 251 VNPRRGSGTRHRY 289 V SG + Y Sbjct: 194 VRRSETSGRYNSY 206 >SPAPB15E9.01c ||SPAPB18E9.06c|sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 1036 Score = 25.4 bits (53), Expect = 8.6 Identities = 11/42 (26%), Positives = 19/42 (45%) Frame = +1 Query: 307 GADTTWKTLEYQQDIRIWRCLNTTATVIGASSRVVLSRDGQP 432 G +TT T Y + + T T+IG ++ ++ G P Sbjct: 851 GTETTEGTATYTEPTTFTSTFSFTTTIIGGTTTIIPVNPGNP 892 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,813,489 Number of Sequences: 5004 Number of extensions: 55976 Number of successful extensions: 106 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 104 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 106 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 353266144 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -