BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30801 (745 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g50010.1 68416.m05468 DC1 domain-containing protein contains ... 28 5.7 At5g11020.1 68418.m01287 protein kinase family protein contains ... 27 9.9 >At3g50010.1 68416.m05468 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 769 Score = 28.3 bits (60), Expect = 5.7 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = -3 Query: 173 WPCSSVTPNTLRLERNRDVSGFVCI 99 W C SV T +L R D F+CI Sbjct: 228 WHCLSVNWRTFKLSREEDTLHFICI 252 >At5g11020.1 68418.m01287 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 372 Score = 27.5 bits (58), Expect = 9.9 Identities = 17/55 (30%), Positives = 28/55 (50%) Frame = -2 Query: 225 ITLSATTGSSGLILVMSLALFFCDAKYSSFRT*S*CFGICLYLALSISRSYPMRS 61 I+L+AT G+IL+ SL +FC + + + C GI S S++ R+ Sbjct: 5 ISLAATFSLVGIILLCSLLYWFCHRRRNLKSSGCGCSGITFLNRFSRSKTLDKRT 59 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,697,847 Number of Sequences: 28952 Number of extensions: 296693 Number of successful extensions: 586 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 574 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 586 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1643603136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -