BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30798 (829 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_0764 + 31589040-31589309,31589322-31589529,31589892-31590193 31 1.1 09_04_0715 + 19697134-19697211,19697212-19697300,19697416-196974... 29 6.0 08_02_0580 - 18953208-18953513,18953668-18953868,18953929-189540... 29 6.0 05_03_0242 + 10823312-10823342,10823662-10823732,10824010-108240... 29 6.0 09_06_0234 - 21747724-21747839,21748027-21748096,21749157-217492... 28 7.9 >02_05_0764 + 31589040-31589309,31589322-31589529,31589892-31590193 Length = 259 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/43 (37%), Positives = 23/43 (53%) Frame = +3 Query: 228 DLRRCQRQIRRWVSTMSRPFEVRFNPHTERVEVLDSVDKLETL 356 D RC+RQ+RR ++ M V + ++V V SVD E L Sbjct: 143 DCERCERQVRRALAGMRGVQHVEVSRRQQKVTVTGSVDPHEVL 185 >09_04_0715 + 19697134-19697211,19697212-19697300,19697416-19697485, 19697756-19697816,19698223-19698461,19698578-19698704, 19698908-19699181,19699479-19699611,19700023-19700109, 19700231-19700365 Length = 430 Score = 28.7 bits (61), Expect = 6.0 Identities = 15/41 (36%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = +1 Query: 37 FTVEFGLCKE-NQQLKAYGAALLSSIGELLHALSDKPELRP 156 F G C E NQ+L AY A + S+ ++LH P +P Sbjct: 191 FVEMLGYCVEGNQRLVAYEFATMGSLHDILHGRKGVPGAQP 231 >08_02_0580 - 18953208-18953513,18953668-18953868,18953929-18954009, 18954096-18954410,18954493-18954636,18954733-18954822, 18954907-18954983,18955122-18955182,18955264-18955490, 18955581-18955740,18955825-18956025,18956114-18956209, 18956380-18956565,18956641-18956810,18957044-18957275, 18958652-18959029 Length = 974 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = -2 Query: 729 PNINGLKGIPAMYNFSSVKWGNSENL 652 PNING +P N SVKW E L Sbjct: 756 PNINGNTEVPVNPNIESVKWFFKERL 781 >05_03_0242 + 10823312-10823342,10823662-10823732,10824010-10824021, 10827329-10827394,10827564-10827766,10827977-10828266, 10828377-10828468,10829876-10830344,10830670-10830978, 10831290-10831364,10831457-10831614 Length = 591 Score = 28.7 bits (61), Expect = 6.0 Identities = 21/61 (34%), Positives = 31/61 (50%), Gaps = 3/61 (4%) Frame = +1 Query: 292 CASTLTQSA*RCSTPL---ISWKLSSGSSTPRCCISPTPLRSSRAHTSSDLLTFTVHNSG 462 C+ L Q A R P+ ISW L + + PR C + L++ + H+ DLL+ H G Sbjct: 429 CSLELNQRAAR-RVPVQTGISWMLET-MANPRQCKAMFRLKAEQIHSLHDLLSSKYHLHG 486 Query: 463 S 465 S Sbjct: 487 S 487 >09_06_0234 - 21747724-21747839,21748027-21748096,21749157-21749294, 21749389-21749493,21750157-21750527,21750612-21750694, 21750803-21751063,21751425-21751606,21752539-21752649, 21752727-21752798,21752883-21753036,21753329-21753341, 21754015-21754084,21754409-21754485,21754582-21754640, 21755327-21755580 Length = 711 Score = 28.3 bits (60), Expect = 7.9 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = -1 Query: 241 HLRRSQLRNRWAGTPGLGRVARMWMQARTVS 149 HL Q W+ +PG+G +A++W + R S Sbjct: 447 HLDSEQEHKFWSNSPGIG-IAQLWAKVRMAS 476 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,606,814 Number of Sequences: 37544 Number of extensions: 492405 Number of successful extensions: 1320 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1281 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1320 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2279943096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -