BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30796 (776 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g36150.1 68414.m04494 protease inhibitor/seed storage/lipid t... 36 0.040 At4g15070.1 68417.m02315 DC1 domain-containing protein contains ... 31 0.85 At1g49490.1 68414.m05547 leucine-rich repeat family protein / ex... 31 1.1 At1g19270.1 68414.m02397 ubiquitin interaction motif-containing ... 29 3.4 At1g30420.1 68414.m03718 ATP-binding cassette transport protein,... 28 6.0 At5g46740.1 68418.m05758 ubiquitin-specific protease 21 (UBP21) ... 28 7.9 At5g31873.1 68418.m03777 hypothetical protein 28 7.9 At5g28120.1 68418.m03396 hypothetical protein 28 7.9 At5g28110.1 68418.m03395 hypothetical protein 28 7.9 At3g30816.1 68416.m03949 hypothetical protein 28 7.9 >At1g36150.1 68414.m04494 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein low similarity to glucoamylase S1/S2 [Precursor] from Saccharomyces cerevisiae [SP|P08640], proteophosphoglycan from Leishmania major [GI:5420387]; contains Pfam protease inhibitor/seed storage/LTP family domain PF00234 Length = 256 Score = 35.5 bits (78), Expect = 0.040 Identities = 14/42 (33%), Positives = 26/42 (61%) Frame = +1 Query: 124 VRHDEPSHQATAHYTPVLSHAAPVLTHAAPLIQHAGPIVHAA 249 VRH P +H +P +SH++P + ++P + H+ P+V A+ Sbjct: 165 VRHSSPP---VSHSSPPVSHSSPPTSRSSPAVSHSSPVVAAS 203 >At4g15070.1 68417.m02315 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 889 Score = 31.1 bits (67), Expect = 0.85 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = -3 Query: 573 SELCTIALNPLWWSAVYSTLRMNHQAGVESIRLSRHHHH 457 ++LC + P+++ VYS ++ + E +LSR HH Sbjct: 668 NKLCQACITPIYFGNVYSCMQCDFSLHEECAKLSRKTHH 706 >At1g49490.1 68414.m05547 leucine-rich repeat family protein / extensin family protein contains similarity to disease resistance protein GI:3894383 from [Lycopersicon esculentum]; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 847 Score = 30.7 bits (66), Expect = 1.1 Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 5/44 (11%) Frame = +1 Query: 343 QLPSNTPIMSKIMLPRSMSSHIPSRIPTPAI-----TSPNTKPV 459 Q P+ + S++ P S S+ PS+ PTP + +PN+KPV Sbjct: 726 QAPTTSSETSQVPTPSSESNQSPSQAPTPILEPVHAPTPNSKPV 769 >At1g19270.1 68414.m02397 ubiquitin interaction motif-containing protein / LIM domain-containing protein weak similarity to LIM-homeobox protein [Mus musculus] GI:2149584, Hic-5 [Mus musculus] GI:664955; contains Pfam profiles PF02809: Ubiquitin interaction motif, PF00412: LIM domain Length = 532 Score = 29.1 bits (62), Expect = 3.4 Identities = 24/88 (27%), Positives = 32/88 (36%), Gaps = 4/88 (4%) Frame = +3 Query: 135 RAFSSSNGTLYPSIESC--CSSTDSRSPFDSTCRSYCSRRPREHSSYIHASPVVQHFSPV 308 R + N +P C CS S F ST +Y + Y V HF P Sbjct: 183 RFLNCLNSLWHPECFRCYGCSQPISEYEF-STSGNYPFHKACYRERYHPKCDVCSHFIPT 241 Query: 309 QHAPVVHHAAIPIAVEH--SDHVEDHAP 386 HA ++ + A P V+ H D P Sbjct: 242 NHAGLIEYRAHPFWVQKYCPSHEHDATP 269 >At1g30420.1 68414.m03718 ATP-binding cassette transport protein, putative contains Pfam profiles PF00005: ABC transporter, PF00664: ABC transporter transmembrane region Length = 1488 Score = 28.3 bits (60), Expect = 6.0 Identities = 14/43 (32%), Positives = 22/43 (51%) Frame = -1 Query: 134 SWRTMLWEDTAWPWPSSITPPWQIAKIEQTTAILKNMLRCLTE 6 SW T L + + P + WQ+ + +QT ++K RC TE Sbjct: 241 SWMTPLMQ-LGYRKPITERDVWQLDQWDQTETLIKRFQRCWTE 282 >At5g46740.1 68418.m05758 ubiquitin-specific protease 21 (UBP21) identical to ubiquitin-specific protease 21 GI:11993482 [Arabidopsis thaliana] Length = 732 Score = 27.9 bits (59), Expect = 7.9 Identities = 25/86 (29%), Positives = 35/86 (40%), Gaps = 3/86 (3%) Frame = +3 Query: 93 PRPCCVFPKHRSP*RAFSSSNGTLYPSIESCCSSTDSRSPFDSTC-RSYCSRRPREHSSY 269 P CC PK A SS+N I++ S S PF T ++ P E+ +Y Sbjct: 526 PDSCCQEPKEEVFHSAESSNNEDSSAMIDA-LGSPQSEKPFAETSQQTEPESCPTENKAY 584 Query: 270 IHAS--PVVQHFSPVQHAPVVHHAAI 341 I S P + P + P A+I Sbjct: 585 IDKSEKPFAETSQPKEPKPFADRASI 610 >At5g31873.1 68418.m03777 hypothetical protein Length = 271 Score = 27.9 bits (59), Expect = 7.9 Identities = 16/44 (36%), Positives = 22/44 (50%) Frame = -3 Query: 432 RRCGDPRRNMRTHTSREHDLRHDRSVRRQLESQRGARLEHVAQG 301 +R DPR N+R R H L +D V + G+ + HVA G Sbjct: 196 KRMLDPRANLRPTEERFHGLAYDDPVDESTDPW-GSIVHHVAGG 238 >At5g28120.1 68418.m03396 hypothetical protein Length = 506 Score = 27.9 bits (59), Expect = 7.9 Identities = 16/44 (36%), Positives = 22/44 (50%) Frame = -3 Query: 432 RRCGDPRRNMRTHTSREHDLRHDRSVRRQLESQRGARLEHVAQG 301 +R DPR N+R R H L +D V + G+ + HVA G Sbjct: 394 KRMLDPRANLRPTEERFHGLAYDDPVDESTDPW-GSIVHHVAGG 436 >At5g28110.1 68418.m03395 hypothetical protein Length = 493 Score = 27.9 bits (59), Expect = 7.9 Identities = 16/44 (36%), Positives = 22/44 (50%) Frame = -3 Query: 432 RRCGDPRRNMRTHTSREHDLRHDRSVRRQLESQRGARLEHVAQG 301 +R DPR N+R R H L +D V + G+ + HVA G Sbjct: 394 KRMLDPRANLRPTEERFHGLAYDDPVDESTDPW-GSIVHHVAGG 436 >At3g30816.1 68416.m03949 hypothetical protein Length = 342 Score = 27.9 bits (59), Expect = 7.9 Identities = 16/44 (36%), Positives = 22/44 (50%) Frame = -3 Query: 432 RRCGDPRRNMRTHTSREHDLRHDRSVRRQLESQRGARLEHVAQG 301 +R DPR N+R R H L +D V + G+ + HVA G Sbjct: 231 KRMLDPRANLRPTEERFHGLAYDDPVDESTDPW-GSIVHHVAGG 273 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,853,135 Number of Sequences: 28952 Number of extensions: 392968 Number of successful extensions: 1452 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1359 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1450 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1736283200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -