BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30791 (873 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-13|CAJ14164.1| 420|Anopheles gambiae predicted protein... 32 0.020 AY428512-1|AAR89530.1| 420|Anopheles gambiae EKN1 protein. 32 0.020 AJ697727-1|CAG26920.1| 285|Anopheles gambiae putative odorant-b... 23 9.2 >CR954257-13|CAJ14164.1| 420|Anopheles gambiae predicted protein protein. Length = 420 Score = 32.3 bits (70), Expect = 0.020 Identities = 15/60 (25%), Positives = 27/60 (45%) Frame = +2 Query: 320 ERLKNEGNELMKAERYNEALEKYTRAIEIDPRNAVYYCNRAAAHFRLCDPEAAVSDCTNS 499 E LK G+ + + A+ Y+ I + + NR+AAH L + + DC+ + Sbjct: 284 EWLKQRGDTFFQQRNFLAAISAYSAGIRLTKDYYALFLNRSAAHLALENYQRCAEDCSTA 343 >AY428512-1|AAR89530.1| 420|Anopheles gambiae EKN1 protein. Length = 420 Score = 32.3 bits (70), Expect = 0.020 Identities = 15/60 (25%), Positives = 27/60 (45%) Frame = +2 Query: 320 ERLKNEGNELMKAERYNEALEKYTRAIEIDPRNAVYYCNRAAAHFRLCDPEAAVSDCTNS 499 E LK G+ + + A+ Y+ I + + NR+AAH L + + DC+ + Sbjct: 284 EWLKQRGDTFFQQRNFLAAISAYSAGIRLTKDYYALFLNRSAAHLALENYQRCAEDCSTA 343 >AJ697727-1|CAG26920.1| 285|Anopheles gambiae putative odorant-binding protein OBPjj17 protein. Length = 285 Score = 23.4 bits (48), Expect = 9.2 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = -2 Query: 443 PRDCSSRPRFLGRSLWRACTF 381 P +C S+P+++ R R C + Sbjct: 55 PNECCSKPQWINRYAVRRCRY 75 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 792,422 Number of Sequences: 2352 Number of extensions: 14525 Number of successful extensions: 240 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 240 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 240 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 93439926 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -