BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30788 (734 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC4G3.11 |mug154||conserved fungal protein|Schizosaccharomyces... 26 4.8 SPAC24H6.09 |gef1||RhoGEF Gef1|Schizosaccharomyces pombe|chr 1||... 25 8.5 >SPCC4G3.11 |mug154||conserved fungal protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 316 Score = 26.2 bits (55), Expect = 4.8 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 460 FQSCTQKKTHNHWYQTKRTTTCNPSIPSMFQ 368 F + Q K + Q KRTTT P++ +FQ Sbjct: 107 FSTRFQNKLYRTLPQDKRTTTSTPNVKPVFQ 137 >SPAC24H6.09 |gef1||RhoGEF Gef1|Schizosaccharomyces pombe|chr 1|||Manual Length = 753 Score = 25.4 bits (53), Expect = 8.5 Identities = 14/35 (40%), Positives = 21/35 (60%), Gaps = 3/35 (8%) Frame = +2 Query: 533 DPLPVKMGIILMQSI-EVVTICT--CTVSSSMFVI 628 DPLP +G+I ++S+ E+ I T C S+F I Sbjct: 391 DPLPCNLGLIFLESLSEIGQIYTGYCNRQDSVFKI 425 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,857,037 Number of Sequences: 5004 Number of extensions: 56461 Number of successful extensions: 127 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 125 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 127 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 347244562 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -