BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30784 (881 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxida... 24 1.8 AM292336-1|CAL23148.2| 455|Tribolium castaneum gustatory recept... 23 3.2 EF592536-1|ABQ95982.1| 598|Tribolium castaneum beta-N-acetylglu... 23 4.2 EU019711-1|ABU25223.1| 534|Tribolium castaneum chitin deacetyla... 21 9.7 AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock prote... 21 9.7 >AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxidase subunit 2 protein. Length = 683 Score = 23.8 bits (49), Expect = 1.8 Identities = 10/33 (30%), Positives = 16/33 (48%) Frame = +2 Query: 131 FHDNAKTYYETDMITLNFEDAQNSVNLLNSAIS 229 F D + E D T+N + QN++ +S S Sbjct: 517 FRDQKIMFIELDKFTVNLKQGQNTITRASSQSS 549 >AM292336-1|CAL23148.2| 455|Tribolium castaneum gustatory receptor candidate 15 protein. Length = 455 Score = 23.0 bits (47), Expect = 3.2 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +2 Query: 605 RRNFQMMKSIVSFRDS 652 R+N +MKS V+FR S Sbjct: 280 RKNLDVMKSFVNFRPS 295 >EF592536-1|ABQ95982.1| 598|Tribolium castaneum beta-N-acetylglucosaminidase NAG1 protein. Length = 598 Score = 22.6 bits (46), Expect = 4.2 Identities = 7/24 (29%), Positives = 14/24 (58%) Frame = +2 Query: 737 YPHMGSGLPMVWWSKVGTQRQEIE 808 Y G +P++ W+ TQ++ +E Sbjct: 411 YKKAGKEIPVILWTSTLTQKEYLE 434 >EU019711-1|ABU25223.1| 534|Tribolium castaneum chitin deacetylase 1 protein. Length = 534 Score = 21.4 bits (43), Expect = 9.7 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = +2 Query: 167 MITLNFEDAQNSVNL 211 MIT+ F+DA N+ N+ Sbjct: 194 MITITFDDAINNNNI 208 >AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock protein 70 protein. Length = 195 Score = 21.4 bits (43), Expect = 9.7 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = +1 Query: 553 KFKELSLDSFFEELRISKEEFSDDEV 630 KF+EL+ D F + L+ K+ D ++ Sbjct: 128 KFEELNNDQFLKTLKPVKKVLEDADM 153 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 224,604 Number of Sequences: 336 Number of extensions: 5277 Number of successful extensions: 22 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 24410188 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -