BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30783 (867 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_14309| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.17 SB_53978| Best HMM Match : Rib_hydrolayse (HMM E-Value=8) 29 6.5 >SB_14309| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 33.9 bits (74), Expect = 0.17 Identities = 14/33 (42%), Positives = 22/33 (66%) Frame = +3 Query: 12 LAALSSAQVARIQQLNSLDLELYDFAKNLMFKR 110 + +++ + R + LNSLD+ LYD+AK L F R Sbjct: 43 MKSMTQIEKRRTKSLNSLDIRLYDYAKALFFYR 75 >SB_53978| Best HMM Match : Rib_hydrolayse (HMM E-Value=8) Length = 219 Score = 28.7 bits (61), Expect = 6.5 Identities = 13/41 (31%), Positives = 23/41 (56%) Frame = -2 Query: 776 GLMSLGILNGIHLWF*FTKTLRWKSSVHIATEEHRPTF*LF 654 GL++ +N LW F+K +K ++ E++RP F L+ Sbjct: 170 GLVNPESVNCNELWEAFSKAFAYKKPCNVTEEDYRPFFELY 210 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,376,645 Number of Sequences: 59808 Number of extensions: 515036 Number of successful extensions: 968 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 875 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 968 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2479240863 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -