BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30783 (867 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 24 2.1 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 23 4.8 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 23 4.8 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 23.8 bits (49), Expect = 2.1 Identities = 16/38 (42%), Positives = 20/38 (52%) Frame = -1 Query: 495 TLY*PCTAS*YLIKSNTN*AVWSCDTFVSPISRKYWLF 382 TL C + Y I+S VW DT V PI+RK +F Sbjct: 507 TLRVTCPVAGYPIES----IVWERDTRVLPINRKQKVF 540 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 22.6 bits (46), Expect = 4.8 Identities = 9/38 (23%), Positives = 16/38 (42%) Frame = -3 Query: 724 PKHYDGNPVYISLPKNTDLHFNCSHSNRKEKGEVSLSW 611 P H + P +S+ + F C S + G ++W Sbjct: 330 PLHVEVTPPLLSVHLGGNAEFRCEVSTHPQAGPHFITW 367 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 22.6 bits (46), Expect = 4.8 Identities = 9/38 (23%), Positives = 16/38 (42%) Frame = -3 Query: 724 PKHYDGNPVYISLPKNTDLHFNCSHSNRKEKGEVSLSW 611 P H + P +S+ + F C S + G ++W Sbjct: 330 PLHVEVTPPLLSVHLGGNAEFRCEVSTHPQAGPHFITW 367 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 233,131 Number of Sequences: 438 Number of extensions: 5141 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 28038087 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -