BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30779 (862 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless prot... 26 0.33 U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 25 0.77 AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholo... 24 1.8 DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc gr... 23 3.1 DQ659251-1|ABG47449.1| 366|Tribolium castaneum chitinase 11 pro... 22 7.2 AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembran... 22 7.2 AF260820-1|AAG02018.1| 139|Tribolium castaneum alpha-esterase l... 22 7.2 >AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless protein. Length = 302 Score = 26.2 bits (55), Expect = 0.33 Identities = 18/55 (32%), Positives = 26/55 (47%) Frame = -3 Query: 431 VLTVVMKNWEPLVSAPALAMERTPGPVCLRVKFSSSNLLP*MDFPPVPLWLVKSP 267 VL + M +EP P++ PGP F +N LP PP+PL + +P Sbjct: 143 VLNLTMPKYEP---NPSII---DPGPALPPAGFLCNNYLPLPQVPPLPLPPIFAP 191 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 25.0 bits (52), Expect = 0.77 Identities = 15/33 (45%), Positives = 19/33 (57%), Gaps = 3/33 (9%) Frame = +2 Query: 299 ESPSTAISLKTR---ISPLSTLDLASSPWLMPV 388 ESP A L R I +ST+DL SS W +P+ Sbjct: 373 ESPPAADELLRRFHEIRYMSTIDLRSSYWQIPL 405 >AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholog protein. Length = 406 Score = 23.8 bits (49), Expect = 1.8 Identities = 19/60 (31%), Positives = 27/60 (45%) Frame = -3 Query: 431 VLTVVMKNWEPLVSAPALAMERTPGPVCLRVKFSSSNLLP*MDFPPVPLWLVKSPPCSMN 252 VL + M +EP P++ PGP F +N P PP+PL + PP +N Sbjct: 143 VLNLTMPKYEP---NPSII---DPGPALPPTGFLCNNYPPLPQVPPLPLPPI-FPPTMIN 195 >DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc growth factor 4 protein. Length = 431 Score = 23.0 bits (47), Expect = 3.1 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +2 Query: 170 TCENFRALCTGEK 208 T ++FR LCTG K Sbjct: 408 TLDDFRGLCTGNK 420 >DQ659251-1|ABG47449.1| 366|Tribolium castaneum chitinase 11 protein. Length = 366 Score = 21.8 bits (44), Expect = 7.2 Identities = 12/38 (31%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = -1 Query: 202 ASAQGTEVFTRLGSDVTSQLNNNFSQWGIVNSDVE-EY 92 A G ++L + + S + FSQWG D++ EY Sbjct: 110 AILNGIVASSKLRASLISSCLSFFSQWGYDGIDIDWEY 147 >AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembrane transporter white protein. Length = 669 Score = 21.8 bits (44), Expect = 7.2 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = +2 Query: 737 IAFISMALLDVPLVAFLPITI 799 I FIS L + P+ +P+T+ Sbjct: 489 IYFISKTLAESPIFIIIPVTL 509 >AF260820-1|AAG02018.1| 139|Tribolium castaneum alpha-esterase like protein E1 protein. Length = 139 Score = 21.8 bits (44), Expect = 7.2 Identities = 12/32 (37%), Positives = 16/32 (50%), Gaps = 1/32 (3%) Frame = +1 Query: 253 FMLQGGDFTNHNGTGGKSIYGNKF-EDENFTL 345 F + GGDF G+G +YG + EN L Sbjct: 78 FWIHGGDFV--TGSGTSEMYGPDYLMSENVVL 107 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 218,500 Number of Sequences: 336 Number of extensions: 5189 Number of successful extensions: 17 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 23866870 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -