BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30777 (806 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC15A10.08 |ain1||alpha-actinin|Schizosaccharomyces pombe|chr ... 26 7.2 SPAC17D4.01 |pex7|SPAC1834.12|peroxin-7 |Schizosaccharomyces pom... 25 9.6 >SPAC15A10.08 |ain1||alpha-actinin|Schizosaccharomyces pombe|chr 1|||Manual Length = 621 Score = 25.8 bits (54), Expect = 7.2 Identities = 10/31 (32%), Positives = 18/31 (58%) Frame = -1 Query: 521 NEYTNISHESNSFSYRKRIDSKAQIKYKNDI 429 N YT++ SN+F+ K + + +K K D+ Sbjct: 284 NNYTDVKSHSNNFAKFKATEKREWVKEKIDL 314 >SPAC17D4.01 |pex7|SPAC1834.12|peroxin-7 |Schizosaccharomyces pombe|chr 1|||Manual Length = 308 Score = 25.4 bits (53), Expect = 9.6 Identities = 10/36 (27%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Frame = +1 Query: 544 YSRNNSKKNWYVNLN*IIFCYDI-SMKQTSRITRGH 648 +S++N + + + N +++CYDI ++K + GH Sbjct: 197 WSKSNHRMVYTADNNNLVYCYDIANLKTPLSVLSGH 232 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,298,891 Number of Sequences: 5004 Number of extensions: 68668 Number of successful extensions: 164 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 156 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 163 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 392429240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -