BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30775 (829 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EU019709-1|ABU25221.1| 540|Tribolium castaneum aspartate 1-deca... 22 5.2 DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 prot... 22 6.8 AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription fa... 22 6.8 DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc gr... 21 9.0 >EU019709-1|ABU25221.1| 540|Tribolium castaneum aspartate 1-decarboxylase protein. Length = 540 Score = 22.2 bits (45), Expect = 5.2 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = -3 Query: 707 WNSHSLLSSGQTC 669 WN H LL++ Q C Sbjct: 348 WNPHKLLTAPQQC 360 >DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 protein. Length = 496 Score = 21.8 bits (44), Expect = 6.8 Identities = 5/12 (41%), Positives = 8/12 (66%) Frame = -1 Query: 193 KYLCYWAHWAVH 158 K +CYW W+ + Sbjct: 25 KVVCYWGTWSTY 36 >AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription factor protein. Length = 441 Score = 21.8 bits (44), Expect = 6.8 Identities = 11/36 (30%), Positives = 16/36 (44%) Frame = -1 Query: 724 FNDHTFGTPILYCLVDKLVESSTNGKYSGNGMHDYK 617 F H I + V +S+ NG+ N +H YK Sbjct: 118 FGAHWMKESISFAKVKLTNKSNGNGQIMLNSLHKYK 153 >DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc growth factor 2 protein. Length = 439 Score = 21.4 bits (43), Expect = 9.0 Identities = 7/18 (38%), Positives = 13/18 (72%) Frame = -3 Query: 536 FRQIAQLSTKYPKPRVLL 483 +R++ L ++PK +VLL Sbjct: 86 YRKVTDLKKRFPKLKVLL 103 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 208,027 Number of Sequences: 336 Number of extensions: 4739 Number of successful extensions: 10 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 22725411 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -