BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30773 (847 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP... 23 4.7 AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive... 23 4.7 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 22 6.2 DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated... 22 8.2 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 22 8.2 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 22 8.2 >Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP57-1 protein. Length = 544 Score = 22.6 bits (46), Expect = 4.7 Identities = 9/32 (28%), Positives = 16/32 (50%) Frame = +3 Query: 618 MVVLTEDFTLAPAVSTYAAAPIVTKVFMPPLL 713 + V E FT+ + A +P+ ++ PLL Sbjct: 243 LTVAGESFTVKNGIYGIALSPVTNNLYYSPLL 274 >AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive opsin protein. Length = 371 Score = 22.6 bits (46), Expect = 4.7 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = +1 Query: 727 PAGPPSWLNTQAPA*GRLLLIGSPWL 804 PAGPP L PA L+ I WL Sbjct: 14 PAGPPRLLGWNVPA-EELIHIPEHWL 38 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 22.2 bits (45), Expect = 6.2 Identities = 16/52 (30%), Positives = 24/52 (46%) Frame = +1 Query: 475 TRSCDVLRACCSKAIAPAVAYAATCGCLQDHQSWQYLLCHLTPSTNSPWWFL 630 T+S V S IAP AATC Q+ +++ + ST S ++ L Sbjct: 925 TKSSAVTATNASSMIAPVALTAATCD--QNKAVKKHITTTIDCSTQSEYYEL 974 >DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 469 Score = 21.8 bits (44), Expect = 8.2 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = +1 Query: 559 QDHQSWQYLLCHLTPST 609 QD+ S YL H PST Sbjct: 373 QDYSSQNYLTVHSFPST 389 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.8 bits (44), Expect = 8.2 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +1 Query: 727 PAGPPSWLNTQAPA*GRLLLIGSP 798 PAGPP L +A + +L+ SP Sbjct: 1006 PAGPPINLEARALSSSEILITWSP 1029 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.8 bits (44), Expect = 8.2 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +1 Query: 727 PAGPPSWLNTQAPA*GRLLLIGSP 798 PAGPP L +A + +L+ SP Sbjct: 1002 PAGPPINLEARALSSSEILITWSP 1025 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 206,226 Number of Sequences: 438 Number of extensions: 4340 Number of successful extensions: 11 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 27188448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -