BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30772 (825 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g15780.1 68417.m02402 synaptobrevin-related family protein si... 34 0.100 At1g05320.1 68414.m00539 myosin-related similar to non-muscle my... 34 0.13 At1g63300.1 68414.m07156 expressed protein similar to Intracellu... 33 0.30 At3g30420.1 68416.m03847 hypothetical protein low similarity to ... 31 0.93 At1g18920.1 68414.m02355 hypothetical protein contains Pfam prof... 30 2.1 At1g62780.1 68414.m07086 expressed protein 29 2.8 At1g74770.1 68414.m08663 expressed protein 29 3.7 At1g12270.1 68414.m01419 stress-inducible protein, putative simi... 29 3.7 At1g04760.1 68414.m00472 synaptobrevin family protein similar to... 29 3.7 At4g14760.1 68417.m02271 M protein repeat-containing protein con... 29 5.0 At2g40630.1 68415.m05011 expressed protein 29 5.0 At5g46090.1 68418.m05667 expressed protein contains Pfam profile... 28 6.5 At3g28790.1 68416.m03593 expressed protein 28 6.5 At2g34230.1 68415.m04188 hypothetical protein contains Pfam prof... 28 6.5 At2g33610.1 68415.m04119 SWIRM domain-containing protein / DNA-b... 28 6.5 At1g52080.1 68414.m05875 actin binding protein family contains P... 28 6.5 At4g18425.1 68417.m02734 expressed protein contains Pfam profile... 28 8.7 At2g32670.1 68415.m03994 synaptobrevin family protein similar to... 28 8.7 At1g11690.1 68414.m01342 hypothetical protein 28 8.7 >At4g15780.1 68417.m02402 synaptobrevin-related family protein similar to Vesicle-associated membrane protein 722 (AtVAMP722) Synaptobrevin-related protein 1 (SP:P47192) {Arabidopsis thaliana} Length = 194 Score = 34.3 bits (75), Expect = 0.100 Identities = 18/58 (31%), Positives = 27/58 (46%) Frame = +2 Query: 209 YARRFATGGRTRENPIERNKELETALRQHQNVIEDQAQEIEYLTKQTVALREVNDSRL 382 + +R+ G + NKE +++H N I D A+EIE L K + EV L Sbjct: 90 FKKRYGGGKASTAIAKSLNKEFGPVMKEHMNYIVDHAEEIEKLIKVKAQVSEVKSIML 147 >At1g05320.1 68414.m00539 myosin-related similar to non-muscle myosin II heavy chain (GI:19879404) [Loligo pealei]; ESTs gb|AA042402,gb|ATTS1380 come from this gene Length = 828 Score = 33.9 bits (74), Expect = 0.13 Identities = 22/61 (36%), Positives = 36/61 (59%), Gaps = 1/61 (1%) Frame = +2 Query: 266 KELETALRQHQNVIED-QAQEIEYLTKQTVALREVNDSRLRIYEQLELSIQDLERANHRL 442 K+L T L+ H+NVIE+ + Q +E EV ++ L++ LE +I++LE+ N L Sbjct: 429 KDLITKLKSHENVIEEHKRQVLEASGVADTRKVEVEEALLKL-NTLESTIEELEKENGDL 487 Query: 443 A 445 A Sbjct: 488 A 488 >At1g63300.1 68414.m07156 expressed protein similar to Intracellular protein transport protein USO1 (Swiss-Prot:P25386) [Saccharomyces cerevisiae]; similar to Myosin II heavy chain, non muscle (Swiss-Prot:P08799) [Dictyostelium discoideum] Length = 1029 Score = 32.7 bits (71), Expect = 0.30 Identities = 20/64 (31%), Positives = 34/64 (53%) Frame = +2 Query: 236 RTRENPIERNKELETALRQHQNVIEDQAQEIEYLTKQTVALREVNDSRLRIYEQLELSIQ 415 R EN E++ E++ R ++V + QEI+ L ++ L++ DS + EQ E Sbjct: 700 RMLENLDEKSNEIDNQKRHEEDVTANLNQEIKILKEEIENLKKNQDSLMLQAEQAENLRV 759 Query: 416 DLER 427 DLE+ Sbjct: 760 DLEK 763 >At3g30420.1 68416.m03847 hypothetical protein low similarity to SP|Q9UUA2 DNA repair and recombination protein pif1, mitochondrial precursor {Schizosaccharomyces pombe} Length = 837 Score = 31.1 bits (67), Expect = 0.93 Identities = 21/56 (37%), Positives = 31/56 (55%) Frame = +2 Query: 269 ELETALRQHQNVIEDQAQEIEYLTKQTVALREVNDSRLRIYEQLELSIQDLERANH 436 E+ET LRQH+ + D E + L EVN+S LR ++ +++I D ER H Sbjct: 293 EIETLLRQHEKSLSDYP---EMPQPEKSILEEVNNSLLR--QEFQINI-DKERETH 342 >At1g18920.1 68414.m02355 hypothetical protein contains Pfam profile PF03794: Domain of Unknown function Length = 980 Score = 29.9 bits (64), Expect = 2.1 Identities = 20/78 (25%), Positives = 40/78 (51%), Gaps = 8/78 (10%) Frame = +2 Query: 311 DQAQEIEYLTKQTVALREVNDSRLRI-------YEQLELSIQDLERANHRLAVDHA-ADK 466 D E+E+L K + L E+ + + + YE+L +S+QD+ ++ H+L +H ++ Sbjct: 688 DHELEVEHLNKVSFLLNELAELNMLVLDHKNVKYEKLCMSLQDICKSIHKLLSEHLHREE 747 Query: 467 KHIKSLCSNIDTVEPNAK 520 + L + T+E K Sbjct: 748 TELWCLFRDCFTIEEQEK 765 >At1g62780.1 68414.m07086 expressed protein Length = 237 Score = 29.5 bits (63), Expect = 2.8 Identities = 31/99 (31%), Positives = 39/99 (39%), Gaps = 5/99 (5%) Frame = +2 Query: 182 ARRSHLTSL-YARRFATGGRTRE---NPIERNKELETALRQHQNVIEDQAQEIEYLTKQT 349 A+ H+ L + RR RE + KE ALRQ + V + A+ IEY Sbjct: 41 AQTGHIARLEFKRRLERDSEAREAFQKQLREEKERRQALRQSRVVPDTAAELIEYFLDTE 100 Query: 350 VALREVNDSRLRIYEQLELSIQ-DLERANHRLAVDHAAD 463 E +RLR E Q LE R AV AD Sbjct: 101 AQEIEYEIARLRGRLNDEFFAQIRLEIGQIRFAVTKTAD 139 >At1g74770.1 68414.m08663 expressed protein Length = 985 Score = 29.1 bits (62), Expect = 3.7 Identities = 21/85 (24%), Positives = 41/85 (48%), Gaps = 1/85 (1%) Frame = +2 Query: 269 ELETALRQHQNVIEDQAQEIEYLTKQTVALREVNDSRLRIYEQLELSIQDLERANHRLAV 448 ELET + I ++ E+ L T+ + R YE+L LS++++ ++ H+L Sbjct: 695 ELETKHFDKVSFILNEMSELNMLVS-TINTTAADHDRKMKYERLCLSLREICKSMHKLLS 753 Query: 449 DHAA-DKKHIKSLCSNIDTVEPNAK 520 +H ++ + L N ++E K Sbjct: 754 EHIQHEETELWGLFRNCFSIEEQEK 778 >At1g12270.1 68414.m01419 stress-inducible protein, putative similar to sti (stress inducible protein) [Glycine max] GI:872116; contains Pfam profile PF00515 TPR Domain Length = 572 Score = 29.1 bits (62), Expect = 3.7 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = +2 Query: 248 NPIERNKELETALRQHQNVIEDQAQEIEYLTKQTVALREV 367 N + K+ ETA++ + IE ++I YLT + E+ Sbjct: 252 NAAYKKKDFETAIQHYSTAIEIDDEDISYLTNRAAVYLEM 291 >At1g04760.1 68414.m00472 synaptobrevin family protein similar to Vesicle-associated membrane protein 722 (AtVAMP722) Synaptobrevin-related protein 1 (SP:P47192) {Arabidopsis thaliana} Length = 220 Score = 29.1 bits (62), Expect = 3.7 Identities = 15/64 (23%), Positives = 28/64 (43%) Frame = +2 Query: 209 YARRFATGGRTRENPIERNKELETALRQHQNVIEDQAQEIEYLTKQTVALREVNDSRLRI 388 + +R+ G + NKE + L++H D +EI L+K + EV + Sbjct: 89 FNKRYGGGKASTAKANSLNKEFGSKLKEHMQYCADHPEEISKLSKVKAQVTEVKGVMMEN 148 Query: 389 YEQL 400 E++ Sbjct: 149 IEKV 152 >At4g14760.1 68417.m02271 M protein repeat-containing protein contains Pfam profile: PF02370 M protein repeat Length = 1676 Score = 28.7 bits (61), Expect = 5.0 Identities = 23/77 (29%), Positives = 38/77 (49%) Frame = +2 Query: 266 KELETALRQHQNVIEDQAQEIEYLTKQTVALREVNDSRLRIYEQLELSIQDLERANHRLA 445 ++ E ++R ++ E EI+ L ++ + L EVN+ Y+Q +I LER Sbjct: 275 RDAEESVRVFRDQSEQAETEIKALKQELLKLNEVNEDLNVRYQQCLETISKLER-----E 329 Query: 446 VDHAADKKHIKSLCSNI 496 V HA D + K L S + Sbjct: 330 VSHAQD--NAKRLSSEV 344 >At2g40630.1 68415.m05011 expressed protein Length = 535 Score = 28.7 bits (61), Expect = 5.0 Identities = 19/55 (34%), Positives = 29/55 (52%), Gaps = 1/55 (1%) Frame = +3 Query: 153 KKFGGNEELEQDDLTSRRCMLDDLQLAAELGKTLSNATRNS-RQPFASIKMLLKI 314 +K GN E+D+L S+R + DL A+ S+ NS +QP S + L K+ Sbjct: 24 EKRNGNGLDEKDELGSKRVKVPDLASDAKTSSLQSHGNSNSVQQPNLSSEKLSKV 78 >At5g46090.1 68418.m05667 expressed protein contains Pfam profile PF05078: Protein of unknown function (DUF679); expression supported by MPSS Length = 214 Score = 28.3 bits (60), Expect = 6.5 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = -1 Query: 549 VKFVHSLL*FFAFGSTVSMFEHNDLMCF 466 + FVH+++ F FG+ V +F+ N + CF Sbjct: 144 IDFVHAIMSFLVFGAVV-LFDQNVVNCF 170 >At3g28790.1 68416.m03593 expressed protein Length = 608 Score = 28.3 bits (60), Expect = 6.5 Identities = 23/98 (23%), Positives = 41/98 (41%), Gaps = 3/98 (3%) Frame = +3 Query: 123 TMSEVMDLV---KKKFGGNEELEQDDLTSRRCMLDDLQLAAELGKTLSNATRNSRQPFAS 293 T SEV + +KK+ GN EL+ + M +L+ K L R++ A Sbjct: 449 TSSEVNSFISNLEKKYTGNSELKVFFEKLKTSMSASAKLSTSNAKELVTGMRSAASKIAE 508 Query: 294 IKMLLKIKHKKSNILQSKRLLCER*MTQG*GFMSNWNS 407 M + + KS ++ C++ + Q + + NS Sbjct: 509 AMMFVSSRFSKSEETKTSMASCQQEVMQSLKELQDINS 546 >At2g34230.1 68415.m04188 hypothetical protein contains Pfam profiles PF04780: Protein of unknown function (DUF629), PF04781: Protein of unknown function (DUF627) Length = 716 Score = 28.3 bits (60), Expect = 6.5 Identities = 16/47 (34%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = +3 Query: 225 QLAAELGKTLSNATRNSRQPFASIKMLLKIK-HKKSNILQSKRLLCE 362 QL ++ ++L + N + +K L ++ H SN+L KRLLCE Sbjct: 416 QLTTDVRESLVSKVVNQLWENSLVKERLDLEGHTNSNLLLDKRLLCE 462 >At2g33610.1 68415.m04119 SWIRM domain-containing protein / DNA-binding family protein contains similarity to SWI/SNF complex 170 KDa subunit [Homo sapiens] gi|1549241|gb|AAC50694; contains Pfam domain PF04433: SWIRM domain, PF00249: Myb-like DNA-binding domain Length = 469 Score = 28.3 bits (60), Expect = 6.5 Identities = 23/86 (26%), Positives = 42/86 (48%), Gaps = 6/86 (6%) Frame = +2 Query: 269 ELETALRQHQNVIEDQAQEIEYLTKQT--VALREVNDSRLRIYEQLELSIQ----DLERA 430 E E A +++IE + E+E K+T V ++++ D R+ +E+L+L ++ LE Sbjct: 384 ESERAWADAKSLIEKEEHEVEGAIKETVEVEMKKIRD-RIVHFEKLDLEMERSRKQLEEV 442 Query: 431 NHRLAVDHAADKKHIKSLCSNIDTVE 508 + L VD H + D +E Sbjct: 443 RNLLFVDQLNIFFHTRKARKTEDRIE 468 >At1g52080.1 68414.m05875 actin binding protein family contains Prosite PS00019: Actinin-type actin-binding domain signature 1; similar to actin binding protein (GI:28071265) [Arabidopsis thaliana]; similar to A-type inclusion protein (ATI) (Swiss-Prot:P16602) [Cowpox virus] Length = 573 Score = 28.3 bits (60), Expect = 6.5 Identities = 20/73 (27%), Positives = 34/73 (46%), Gaps = 4/73 (5%) Frame = +2 Query: 245 ENPIERNKELETALRQHQNVIEDQAQEIEYLTKQTVALREVNDSRLRIYEQ----LELSI 412 EN I R + ALR+ + +ED+ E L +Q E+ SRL++ + I Sbjct: 138 ENEINRLRNTVRALRERERCLEDKLLEYYSLKEQQKIAMELR-SRLKLNQMETKVFNFKI 196 Query: 413 QDLERANHRLAVD 451 + L+ N +L + Sbjct: 197 KKLQAENEKLKAE 209 >At4g18425.1 68417.m02734 expressed protein contains Pfam profile PF05078: Protein of unknown function (DUF679) Length = 213 Score = 27.9 bits (59), Expect = 8.7 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = -1 Query: 549 VKFVHSLL*FFAFGSTVSMFEHNDLMCF 466 + FVH+ + F FG+ V +F+ N + CF Sbjct: 143 IDFVHAFMSLFVFGAVV-LFDRNAVNCF 169 >At2g32670.1 68415.m03994 synaptobrevin family protein similar to vesicle-associated membrane protein 7 [Rattus norvegicus] GI:9502258, SP|P51809 Synaptobrevin-like protein 1 {Homo sapiens}; contains Pfam profile PF00957: Synaptobrevin Length = 285 Score = 27.9 bits (59), Expect = 8.7 Identities = 15/64 (23%), Positives = 26/64 (40%) Frame = +2 Query: 209 YARRFATGGRTRENPIERNKELETALRQHQNVIEDQAQEIEYLTKQTVALREVNDSRLRI 388 + +R+ G T N+E + L++H D EI L K + EV + Sbjct: 154 FNKRYGGGKATTAQANSLNREFGSKLKEHMQYCVDHPDEISKLAKVKAQVTEVKGVMMEN 213 Query: 389 YEQL 400 E++ Sbjct: 214 IEKV 217 >At1g11690.1 68414.m01342 hypothetical protein Length = 247 Score = 27.9 bits (59), Expect = 8.7 Identities = 26/105 (24%), Positives = 48/105 (45%), Gaps = 4/105 (3%) Frame = +2 Query: 236 RTRENPIERNKELETA---LRQHQNVIEDQAQE-IEYLTKQTVALREVNDSRLRIYEQLE 403 R +E E+ K ET +R +N E+ ++YL ++ RE +L+ Sbjct: 48 RIKELEAEKFKSEETIRCLIRNQRNEKEETTNPFVDYLKEKLSKEREEKKRVKAENSRLK 107 Query: 404 LSIQDLERANHRLAVDHAADKKHIKSLCSNIDTVEPNAKNYKRLW 538 I D+E + +RL + +K + L + ID ++ N +R+W Sbjct: 108 KKILDMESSVNRLRRERDTMEKVCEELVTRIDELKVNT---RRVW 149 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,001,344 Number of Sequences: 28952 Number of extensions: 302635 Number of successful extensions: 894 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 861 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 893 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1892353600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -