BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30770 (827 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_01_0684 + 5828947-5829012,5831123-5832103,5832200-5832326,583... 31 1.1 02_03_0390 + 18448671-18448889,18449567-18449632,18449702-184497... 29 6.0 >12_01_0684 + 5828947-5829012,5831123-5832103,5832200-5832326, 5832623-5832705,5832752-5832917,5833337-5833399, 5833624-5833733,5834227-5834276,5834528-5834664, 5835180-5835281,5835871-5835988,5836575-5836627, 5836710-5836813,5836910-5836972,5837375-5837503, 5837508-5837605,5838446-5838500,5839260-5839311, 5839996-5840113,5841906-5842035,5842156-5842437 Length = 1028 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/35 (45%), Positives = 20/35 (57%) Frame = +1 Query: 211 TKLVKDSRLHKAKTFLSNANL*CDIMFIFHVCDLI 315 T LVK +L + +L ANL CDI F F V L+ Sbjct: 379 TSLVKFGQLEDIRRYLEVANLLCDISFSFSVVFLV 413 >02_03_0390 + 18448671-18448889,18449567-18449632,18449702-18449761, 18449864-18449959,18452287-18452447,18452669-18452790, 18452872-18453239,18453653-18453739,18453835-18453969, 18454349-18454471,18454771-18454854,18455023-18455187, 18455310-18455486,18455660-18455773,18455912-18456016, 18457056-18457174,18457244-18457385,18457461-18457555, 18457757-18457862,18458125-18458204,18458285-18458461, 18459828-18459912,18460024-18460104,18460208-18460351, 18460468-18460563,18460654-18460854,18461462-18461895, 18462417-18462478,18462622-18462872,18462956-18463030, 18463110-18463300,18463696-18463867,18463956-18464020, 18464646-18464778,18464861-18464962,18465047-18465130, 18465656-18465730,18465818-18465877,18465967-18466223, 18466560-18466608,18466781-18466941,18467013-18467079, 18467174-18467299,18467422-18467592,18468566-18468769, 18469059-18469165,18469608-18469737,18469774-18469959, 18470704-18470742 Length = 2202 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = +3 Query: 123 LIMRLSAHLLSNSLFKCIFTVFCICVLAINKT 218 +I ++SA+ + ++K F VF C LA NKT Sbjct: 323 IIYQISAYYVQIMVYKHSFPVFTTCCLASNKT 354 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,592,653 Number of Sequences: 37544 Number of extensions: 326180 Number of successful extensions: 483 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 470 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 483 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2279943096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -