BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30769 (847 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory recept... 23 3.0 AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory recept... 23 4.0 AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory recept... 23 4.0 AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 23 4.0 AF265213-1|AAF75277.1| 143|Tribolium castaneum putative cytochr... 22 5.3 >AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory receptor candidate 41 protein. Length = 398 Score = 23.0 bits (47), Expect = 3.0 Identities = 6/23 (26%), Positives = 14/23 (60%) Frame = -2 Query: 201 HSAYQRSQFIKKNENLFDNLCTI 133 HS + +K+++NL + +C + Sbjct: 200 HSTHLNGDIVKEHQNLHNKICNL 222 >AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory receptor candidate 16 protein. Length = 452 Score = 22.6 bits (46), Expect = 4.0 Identities = 12/35 (34%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = -3 Query: 188 KDHNSLKKMKTYLIISVRSI-FIPNTYTLFWIEAF 87 KDHNSL + L I+V I + ++Y + ++ F Sbjct: 245 KDHNSLYSLHLLLWITVTFILLVGDSYIVMYVFFF 279 >AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory receptor candidate 5 protein. Length = 522 Score = 22.6 bits (46), Expect = 4.0 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -3 Query: 128 FIPNTYTLFWIEAFSVG 78 F P Y+L WI F++G Sbjct: 28 FSPKGYSLLWILLFTLG 44 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 22.6 bits (46), Expect = 4.0 Identities = 12/39 (30%), Positives = 17/39 (43%) Frame = -2 Query: 225 NGTVSNRKHSAYQRSQFIKKNENLFDNLCTIHFHSEHIH 109 N + N+K+S Q +Q N +N H HIH Sbjct: 293 NRRMKNKKNSQRQAAQQQNNNNAATNNQNHHHHAGHHIH 331 >AF265213-1|AAF75277.1| 143|Tribolium castaneum putative cytochrome P450 monooxigenaseCYP4Q3 protein. Length = 143 Score = 22.2 bits (45), Expect = 5.3 Identities = 8/26 (30%), Positives = 13/26 (50%) Frame = +1 Query: 247 FVINKRCAIEKQLLSHLQCFSVHKNP 324 FV + K ++HL + +H NP Sbjct: 90 FVTCNGLKLPKSTITHLHIYDLHHNP 115 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 201,809 Number of Sequences: 336 Number of extensions: 4363 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 23348025 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -