BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30769 (847 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_01_0786 - 5881178-5881303,5881523-5881627,5882078-5882169,588... 29 3.5 >06_01_0786 - 5881178-5881303,5881523-5881627,5882078-5882169, 5882267-5882336,5882639-5882724,5882916-5883017, 5883375-5883597,5883693-5883758,5883896-5883986, 5884019-5884057,5885401-5885548,5885623-5885715, 5885782-5885886,5886645-5886826,5886912-5887084 Length = 566 Score = 29.5 bits (63), Expect = 3.5 Identities = 16/50 (32%), Positives = 29/50 (58%), Gaps = 3/50 (6%) Frame = -2 Query: 702 RLFKISMGNISVRQNSPKY---VFISANGITNPHYTKSSSFRINNSNLTS 562 RL+K ++G+ S + +P Y V A+G+ +PH+ + + +SNL S Sbjct: 111 RLYKQTIGDNSAQPLTPDYTGSVLRYADGVFDPHFCRYVTIMEGSSNLNS 160 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,449,407 Number of Sequences: 37544 Number of extensions: 417827 Number of successful extensions: 740 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 723 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 740 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2350456800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -