BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30769 (847 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_655| Best HMM Match : 7tm_1 (HMM E-Value=4.8e-20) 30 2.1 SB_27746| Best HMM Match : MAM (HMM E-Value=1.4013e-45) 30 2.7 SB_25685| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_29191| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 >SB_655| Best HMM Match : 7tm_1 (HMM E-Value=4.8e-20) Length = 376 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/44 (29%), Positives = 24/44 (54%) Frame = -2 Query: 675 ISVRQNSPKYVFISANGITNPHYTKSSSFRINNSNLTSLKTPFW 544 + + +N + ++ SA+ + + SF +NNS SL +PFW Sbjct: 1 MDIPRNYSQTLYNSASNSLTHNNSTGDSFTLNNSTSISLASPFW 44 >SB_27746| Best HMM Match : MAM (HMM E-Value=1.4013e-45) Length = 622 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -3 Query: 224 TGRCPTENTQPIKDHNSLKKMKTYLII 144 +G+ PTE T P DH++L +YL I Sbjct: 349 SGKTPTEKTGPSNDHSTLSDKGSYLYI 375 >SB_25685| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1170 Score = 29.5 bits (63), Expect = 3.6 Identities = 17/47 (36%), Positives = 23/47 (48%) Frame = -3 Query: 215 CPTENTQPIKDHNSLKKMKTYLIISVRSIFIPNTYTLFWIEAFSVGP 75 CP EN P+K ++KK+K Y+ V I + T I FS P Sbjct: 41 CPQENDCPLKCRKTIKKIKNYVKSIVDMGDISDQGTHVGIITFSTDP 87 >SB_29191| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 428 Score = 29.1 bits (62), Expect = 4.7 Identities = 17/42 (40%), Positives = 25/42 (59%), Gaps = 3/42 (7%) Frame = -3 Query: 245 FRLQHHKTGRCPTENTQPIKD---HNSLKKMKTYLIISVRSI 129 F + ++ T C TEN + IKD +SLKKM+T LI + + Sbjct: 243 FHIGYYST--CITENLKKIKDKSQQSSLKKMQTSLITKAKEL 282 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,949,949 Number of Sequences: 59808 Number of extensions: 512048 Number of successful extensions: 1092 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 958 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1082 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2395401800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -