BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30767 (763 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 25 0.58 X72577-1|CAA51169.1| 283|Apis mellifera Apidaecin precursor pro... 25 1.0 DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 22 7.1 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 25.4 bits (53), Expect = 0.58 Identities = 19/64 (29%), Positives = 31/64 (48%), Gaps = 3/64 (4%) Frame = +3 Query: 438 KALENRTNMEDDRVAILEAQLS---QATSFAEESDKKYEEVARKLVLMEQDLERAEERAE 608 K L N N D R E +L +A +E +++YE++ RK++L E +L Sbjct: 16 KQLRNEDNKIDLRSRTKEERLQYRREAWLVQQEREQEYEKLKRKMIL-EYELYIKYSHTH 74 Query: 609 TKRL 620 K+L Sbjct: 75 EKKL 78 >X72577-1|CAA51169.1| 283|Apis mellifera Apidaecin precursor protein. Length = 283 Score = 24.6 bits (51), Expect = 1.0 Identities = 26/100 (26%), Positives = 38/100 (38%), Gaps = 6/100 (6%) Frame = -2 Query: 549 PLRISCPTPRRMKLPVTVEPPRWQRDHPPCWCGSPAP-----CVFARIHRRPGWPRTAWR 385 P+ IS P P +L EP ++ P + P P A + PG R + Sbjct: 102 PVYISQPRPPHPRLRREAEPEAEPGNNRPVYIPQPRPPHPRLRREAELEAEPGNNRPVYI 161 Query: 384 WRSRDA-PRTSRGPPPAVGYVGSGQPLRTQRSAEPSPSLR 268 + R PR R P G+ +P+ + P P LR Sbjct: 162 SQPRPPHPRLRREAEPE-AEPGNNRPVYIPQPRPPHPRLR 200 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 21.8 bits (44), Expect = 7.1 Identities = 9/51 (17%), Positives = 24/51 (47%) Frame = +3 Query: 447 ENRTNMEDDRVAILEAQLSQATSFAEESDKKYEEVARKLVLMEQDLERAEE 599 + RT DRV LEA+ + ++ + + + L ++++ ++ + Sbjct: 338 DRRTRHLSDRVVALEAEKKNLSKVIDQHSQLIDTLENVLAIVDRLMDETNQ 388 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 167,952 Number of Sequences: 438 Number of extensions: 4228 Number of successful extensions: 8 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 23789892 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -