BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30764 (336 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292341-1|CAL23153.2| 393|Tribolium castaneum gustatory recept... 23 0.86 EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglu... 21 4.6 AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neu... 20 6.0 AM292366-1|CAL23178.2| 379|Tribolium castaneum gustatory recept... 20 6.0 AM292329-1|CAL23141.2| 379|Tribolium castaneum gustatory recept... 20 6.0 >AM292341-1|CAL23153.2| 393|Tribolium castaneum gustatory receptor candidate 20 protein. Length = 393 Score = 23.0 bits (47), Expect = 0.86 Identities = 11/39 (28%), Positives = 18/39 (46%) Frame = -1 Query: 237 GGNTFLAALACLLHFIAAGLSLVAKHLRPGLLSLLPVDV 121 G +T L +CLLH + L+ + G L + + V Sbjct: 268 GVHTLLILFSCLLHLVVTPYYLLIEVCNAGYLPFILLQV 306 >EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglucosaminidase FDL protein. Length = 630 Score = 20.6 bits (41), Expect = 4.6 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = -3 Query: 205 PPSLYCGGPQPGR 167 P SLYCG P G+ Sbjct: 356 PWSLYCGEPPCGQ 368 >AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neuroblasts defectiveprotein protein. Length = 224 Score = 20.2 bits (40), Expect = 6.0 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +1 Query: 253 LRPSLEKTKPRLP 291 L PSL T+P LP Sbjct: 25 LPPSLSDTRPMLP 37 >AM292366-1|CAL23178.2| 379|Tribolium castaneum gustatory receptor candidate 45 protein. Length = 379 Score = 20.2 bits (40), Expect = 6.0 Identities = 11/43 (25%), Positives = 19/43 (44%) Frame = -1 Query: 225 FLAALACLLHFIAAGLSLVAKHLRPGLLSLLPVDVLHEHTLVL 97 F LLHF+ LSL K + +L ++ E +++ Sbjct: 174 FCVLYVVLLHFLTYNLSLGIKLRYDDVNNLFRIEESEEKNIIV 216 >AM292329-1|CAL23141.2| 379|Tribolium castaneum gustatory receptor candidate 8 protein. Length = 379 Score = 20.2 bits (40), Expect = 6.0 Identities = 11/43 (25%), Positives = 19/43 (44%) Frame = -1 Query: 225 FLAALACLLHFIAAGLSLVAKHLRPGLLSLLPVDVLHEHTLVL 97 F LLHF+ LSL K + +L ++ E +++ Sbjct: 174 FCVLYVVLLHFLTYNLSLGIKLRYDDVNNLFRIEESEEKNIIV 216 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 61,053 Number of Sequences: 336 Number of extensions: 1035 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 49 effective length of database: 106,121 effective search space used: 6579502 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.3 bits)
- SilkBase 1999-2023 -