BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30764 (336 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF002196-4|AAB53979.1| 198|Caenorhabditis elegans Ribosomal pro... 84 2e-17 AC024830-6|AAF59601.3| 603|Caenorhabditis elegans Hypothetical ... 27 2.5 U41531-4|AAR85902.1| 578|Caenorhabditis elegans Guanylyl cyclas... 27 4.4 U41531-3|AAR85901.1| 702|Caenorhabditis elegans Guanylyl cyclas... 27 4.4 U41531-2|AAR85900.1| 594|Caenorhabditis elegans Guanylyl cyclas... 27 4.4 AY275184-1|AAP32292.1| 594|Caenorhabditis elegans soluble guany... 27 4.4 AY275183-1|AAP32291.1| 578|Caenorhabditis elegans soluble guany... 27 4.4 AY275182-1|AAP32290.1| 702|Caenorhabditis elegans soluble guany... 27 4.4 Z81063-1|CAB02952.1| 376|Caenorhabditis elegans Hypothetical pr... 26 7.7 AL021503-1|CAA16420.2| 309|Caenorhabditis elegans Hypothetical ... 26 7.7 >AF002196-4|AAB53979.1| 198|Caenorhabditis elegans Ribosomal protein, large subunitprotein 19 protein. Length = 198 Score = 84.2 bits (199), Expect = 2e-17 Identities = 37/58 (63%), Positives = 46/58 (79%) Frame = +1 Query: 1 VLRKLLLKYRTAKKIDRHLYHSLYMKAKGNVFKNKRVLMEYIHRKKAEKARTKMLSDQ 174 VLR LL +YR AKK+D+HLYH LY++AKGN FKNK+ L+EYI +KK E R K L+DQ Sbjct: 101 VLRNLLRRYRDAKKLDKHLYHELYLRAKGNNFKNKKNLIEYIFKKKTENKRAKQLADQ 158 >AC024830-6|AAF59601.3| 603|Caenorhabditis elegans Hypothetical protein Y55F3BR.8a protein. Length = 603 Score = 27.5 bits (58), Expect = 2.5 Identities = 10/16 (62%), Positives = 14/16 (87%) Frame = -2 Query: 50 LSIFLAVLYFRSNFLK 3 L++ LA++YFRSNF K Sbjct: 8 LAVILAIIYFRSNFSK 23 >U41531-4|AAR85902.1| 578|Caenorhabditis elegans Guanylyl cyclase protein 31, isoformc protein. Length = 578 Score = 26.6 bits (56), Expect = 4.4 Identities = 13/43 (30%), Positives = 25/43 (58%) Frame = -1 Query: 201 LHFIAAGLSLVAKHLRPGLLSLLPVDVLHEHTLVLEHITLRLH 73 LH++ + +++ L + + +D+ EH L LEH+ +RLH Sbjct: 17 LHYVQGQIRNISQELFQTEVVIELLDI--EHDLNLEHVIMRLH 57 >U41531-3|AAR85901.1| 702|Caenorhabditis elegans Guanylyl cyclase protein 31, isoformb protein. Length = 702 Score = 26.6 bits (56), Expect = 4.4 Identities = 13/43 (30%), Positives = 25/43 (58%) Frame = -1 Query: 201 LHFIAAGLSLVAKHLRPGLLSLLPVDVLHEHTLVLEHITLRLH 73 LH++ + +++ L + + +D+ EH L LEH+ +RLH Sbjct: 141 LHYVQGQIRNISQELFQTEVVIELLDI--EHDLNLEHVIMRLH 181 >U41531-2|AAR85900.1| 594|Caenorhabditis elegans Guanylyl cyclase protein 31, isoforma protein. Length = 594 Score = 26.6 bits (56), Expect = 4.4 Identities = 13/43 (30%), Positives = 25/43 (58%) Frame = -1 Query: 201 LHFIAAGLSLVAKHLRPGLLSLLPVDVLHEHTLVLEHITLRLH 73 LH++ + +++ L + + +D+ EH L LEH+ +RLH Sbjct: 141 LHYVQGQIRNISQELFQTEVVIELLDI--EHDLNLEHVIMRLH 181 >AY275184-1|AAP32292.1| 594|Caenorhabditis elegans soluble guanylyl cyclase GCY-31c protein. Length = 594 Score = 26.6 bits (56), Expect = 4.4 Identities = 13/43 (30%), Positives = 25/43 (58%) Frame = -1 Query: 201 LHFIAAGLSLVAKHLRPGLLSLLPVDVLHEHTLVLEHITLRLH 73 LH++ + +++ L + + +D+ EH L LEH+ +RLH Sbjct: 141 LHYVQGQIRNISQELFQTEVVIELLDI--EHDLNLEHVIMRLH 181 >AY275183-1|AAP32291.1| 578|Caenorhabditis elegans soluble guanylyl cyclase GCY-31b protein. Length = 578 Score = 26.6 bits (56), Expect = 4.4 Identities = 13/43 (30%), Positives = 25/43 (58%) Frame = -1 Query: 201 LHFIAAGLSLVAKHLRPGLLSLLPVDVLHEHTLVLEHITLRLH 73 LH++ + +++ L + + +D+ EH L LEH+ +RLH Sbjct: 17 LHYVQGQIRNISQELFQTEVVIELLDI--EHDLNLEHVIMRLH 57 >AY275182-1|AAP32290.1| 702|Caenorhabditis elegans soluble guanylyl cyclase GCY-31a protein. Length = 702 Score = 26.6 bits (56), Expect = 4.4 Identities = 13/43 (30%), Positives = 25/43 (58%) Frame = -1 Query: 201 LHFIAAGLSLVAKHLRPGLLSLLPVDVLHEHTLVLEHITLRLH 73 LH++ + +++ L + + +D+ EH L LEH+ +RLH Sbjct: 141 LHYVQGQIRNISQELFQTEVVIELLDI--EHDLNLEHVIMRLH 181 >Z81063-1|CAB02952.1| 376|Caenorhabditis elegans Hypothetical protein F15D3.2 protein. Length = 376 Score = 25.8 bits (54), Expect = 7.7 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = -3 Query: 238 WRQYVPRGACVPP 200 W QY P+G C+ P Sbjct: 224 WHQYQPKGTCIQP 236 >AL021503-1|CAA16420.2| 309|Caenorhabditis elegans Hypothetical protein Y68A4A.2 protein. Length = 309 Score = 25.8 bits (54), Expect = 7.7 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = -2 Query: 176 AWSLSIFVLAFSAFFLWMYSMSTRLF 99 A+ + IFVLA FFL+ + S ++F Sbjct: 119 AFHVLIFVLAVERFFLYFFPSSEKVF 144 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,920,607 Number of Sequences: 27780 Number of extensions: 95994 Number of successful extensions: 244 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 231 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 244 length of database: 12,740,198 effective HSP length: 72 effective length of database: 10,740,038 effective search space used: 418861482 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -