BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30761 (760 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAP8A3.02c |||2 OG-Fe|Schizosaccharomyces pombe|chr 1|||Manual 29 0.95 SPAC57A10.12c |ura3||dihydroorotate dehydrogenase Ura3|Schizosac... 26 6.7 SPBC1685.14c |||Vid27 family protein|Schizosaccharomyces pombe|c... 26 6.7 SPAC589.02c |med13|spTrap240, srb9|mediator complex subunit Srb9... 25 8.9 >SPAP8A3.02c |||2 OG-Fe|Schizosaccharomyces pombe|chr 1|||Manual Length = 225 Score = 28.7 bits (61), Expect = 0.95 Identities = 10/37 (27%), Positives = 21/37 (56%) Frame = +3 Query: 30 IIRVTTVRQYSSLSRCLPNAVDASPVNNIPPDA*SLF 140 ++ V T+ + CLP +V + +NN+P + S++ Sbjct: 42 VVPVETIEGINYYPNCLPESVQRNLINNVPKELLSIY 78 >SPAC57A10.12c |ura3||dihydroorotate dehydrogenase Ura3|Schizosaccharomyces pombe|chr 1|||Manual Length = 443 Score = 25.8 bits (54), Expect = 6.7 Identities = 11/37 (29%), Positives = 17/37 (45%) Frame = +3 Query: 582 DAIAALKTCQVDGKTYREGEIFEPQNTRKTASVHPTG 692 D LK C++DG + P+ + T+ V TG Sbjct: 318 DIADVLKKCKIDGVIVGNTTVQRPKTLKSTSHVEETG 354 >SPBC1685.14c |||Vid27 family protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 801 Score = 25.8 bits (54), Expect = 6.7 Identities = 11/29 (37%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = +3 Query: 111 NIPPDA*SLFKLFHLKFVWNKID-NESAF 194 ++ D +F HL F+WN D N +AF Sbjct: 296 SVDADMNPVFSFEHLSFIWNYFDANSNAF 324 >SPAC589.02c |med13|spTrap240, srb9|mediator complex subunit Srb9|Schizosaccharomyces pombe|chr 1|||Manual Length = 1223 Score = 25.4 bits (53), Expect = 8.9 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = -2 Query: 123 PVEYCLLETRLPHLADSDLMTNIDEL 46 P+E C LET + D L +N+ +L Sbjct: 291 PLELCFLETSALRMNDDSLSSNLTDL 316 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,211,905 Number of Sequences: 5004 Number of extensions: 69400 Number of successful extensions: 183 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 177 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 183 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 363302114 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -