BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30760 (701 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U80442-5|AAB37668.2| 794|Caenorhabditis elegans Hypothetical pr... 30 1.8 Z81513-5|CAB04175.1| 332|Caenorhabditis elegans Hypothetical pr... 29 3.2 U02289-1|AAA18934.1| 1439|Caenorhabditis elegans GTPase-activati... 27 9.8 L16687-1|AAK71357.2| 1317|Caenorhabditis elegans Hypothetical pr... 27 9.8 >U80442-5|AAB37668.2| 794|Caenorhabditis elegans Hypothetical protein T20F5.6 protein. Length = 794 Score = 29.9 bits (64), Expect = 1.8 Identities = 15/41 (36%), Positives = 22/41 (53%) Frame = +1 Query: 118 DPEAKAEYPRSNKLVIRQALLGPDAKPDELNVIQVEAMSLQ 240 + EA A R+ K + ALL PDA PD N ++ + +Q Sbjct: 690 EAEANANGQRAPKNIEMPALLNPDANPDAPNFKNLQPLQVQ 730 >Z81513-5|CAB04175.1| 332|Caenorhabditis elegans Hypothetical protein F26D2.4 protein. Length = 332 Score = 29.1 bits (62), Expect = 3.2 Identities = 16/41 (39%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = -3 Query: 684 RYNYT*NGDGTTSPKWVSRRFVHFLAFFLGDAA-LPLALFD 565 RYNY D T+ + + R HF+ + L A LP AL D Sbjct: 120 RYNYLVRTDSTSQSRKIKRVIQHFINYLLAFLAFLPAALED 160 >U02289-1|AAA18934.1| 1439|Caenorhabditis elegans GTPase-activating protein protein. Length = 1439 Score = 27.5 bits (58), Expect = 9.8 Identities = 16/39 (41%), Positives = 22/39 (56%) Frame = +2 Query: 47 VKSS*RTSFSMVSPFHHHISQRHGIQRQKQNTHAATSSS 163 V SS +T + S FHHH SQ G R +N A T+++ Sbjct: 700 VPSSSQTMATTSSSFHHHSSQA-GPSRDIENGEAPTATA 737 >L16687-1|AAK71357.2| 1317|Caenorhabditis elegans Hypothetical protein C04D8.1 protein. Length = 1317 Score = 27.5 bits (58), Expect = 9.8 Identities = 16/39 (41%), Positives = 22/39 (56%) Frame = +2 Query: 47 VKSS*RTSFSMVSPFHHHISQRHGIQRQKQNTHAATSSS 163 V SS +T + S FHHH SQ G R +N A T+++ Sbjct: 578 VPSSSQTMATTSSSFHHHSSQA-GPSRDIENGEAPTATA 615 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,538,913 Number of Sequences: 27780 Number of extensions: 277950 Number of successful extensions: 679 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 651 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 677 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1624019012 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -