BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30759 (760 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_20402| Best HMM Match : Transformer (HMM E-Value=2.1) 51 1e-06 SB_13467| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 46 4e-05 SB_7775| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_5602| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_29359| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_30216| Best HMM Match : TIL (HMM E-Value=3.1) 40 0.002 SB_14965| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_6863| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_49647| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_6844| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_55300| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.062 SB_53216| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.062 SB_27787| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.062 SB_24856| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.062 SB_16637| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.062 SB_58055| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_54389| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_53289| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_51835| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_49224| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_48809| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_41857| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_40886| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_40435| Best HMM Match : DUF1677 (HMM E-Value=4.2) 34 0.11 SB_27353| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_9214| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_5959| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_3984| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_47626| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_52007| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_9493| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.44 SB_46486| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=0.7) 30 1.8 SB_19187| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_40315| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_32500| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_24543| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_20448| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_5288| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_4968| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_3995| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_1350| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_59236| Best HMM Match : Attractin (HMM E-Value=8.2) 30 2.3 SB_53668| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_53194| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_47973| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_40285| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_24609| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_19053| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_16426| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_15603| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_24059| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_37973| Best HMM Match : ABC_tran (HMM E-Value=0) 29 3.1 SB_1848| Best HMM Match : Galactosyl_T (HMM E-Value=1.4e-26) 29 5.4 SB_161| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.4 SB_54195| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.2 SB_29448| Best HMM Match : DnaJ (HMM E-Value=0.00022) 28 7.2 SB_23401| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.2 SB_13439| Best HMM Match : DnaJ (HMM E-Value=5.9e-24) 28 7.2 >SB_20402| Best HMM Match : Transformer (HMM E-Value=2.1) Length = 276 Score = 50.8 bits (116), Expect = 1e-06 Identities = 31/64 (48%), Positives = 36/64 (56%) Frame = -3 Query: 620 PAVMSDQRLSWCPMSVF*APYNTFGSSHSASSAYQNWPLGTVIRSPASSFE*AGVLTHLK 441 P V SD+R W PY FGSS ASS YQN P T I P + + G+LT+LK Sbjct: 62 PFVGSDERRLW-------HPYRAFGSSRIASSGYQNGPTRTRIHCPGFNKQ-VGLLTNLK 113 Query: 440 FENR 429 FENR Sbjct: 114 FENR 117 >SB_13467| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 38 Score = 46.0 bits (104), Expect = 3e-05 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = -1 Query: 253 NRYGPPSGFPLTST*PGIVHHLSGPSICA 167 NRY PP FPL S GIVHHLSGP+ CA Sbjct: 1 NRYEPPPEFPLASPYSGIVHHLSGPNRCA 29 >SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) Length = 1060 Score = 45.6 bits (103), Expect = 4e-05 Identities = 22/35 (62%), Positives = 24/35 (68%) Frame = +2 Query: 560 KAPKKRSWDTMKGVGRS*QQDGGHGSRNPLRSVQR 664 + +RS D KGVG S QQDGGHGS NPLR QR Sbjct: 10 RCQSRRSSDPTKGVGCSRQQDGGHGSWNPLRKGQR 44 >SB_7775| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 43.2 bits (97), Expect = 2e-04 Identities = 23/33 (69%), Positives = 25/33 (75%), Gaps = 1/33 (3%) Frame = -3 Query: 260 HV-ESLRSSIRVSPDFDLTRHSSPSFGSQHLCS 165 HV ESLR+S RVS F L RHSSPSFGSQ + S Sbjct: 32 HVHESLRASTRVSSGFTLFRHSSPSFGSQQMRS 64 >SB_5602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 41.9 bits (94), Expect = 5e-04 Identities = 20/36 (55%), Positives = 23/36 (63%) Frame = +2 Query: 560 KAPKKRSWDTMKGVGRS*QQDGGHGSRNPLRSVQRT 667 + +RS D KGVG S QQDGGHGS NPL+ T Sbjct: 10 RCQSRRSSDPTKGVGCSRQQDGGHGSWNPLKECVTT 45 Score = 30.3 bits (65), Expect = 1.8 Identities = 15/26 (57%), Positives = 16/26 (61%) Frame = +3 Query: 657 CNELHLPKQPALKMDGAETFCLYTTV 734 C LPKQ ALKMDGA+ LY V Sbjct: 42 CVTTPLPKQLALKMDGAQASHLYRAV 67 >SB_29359| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 33 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/25 (80%), Positives = 21/25 (84%) Frame = +3 Query: 573 NAHGTP*KALVAHDSRTVAMEVGIR 647 +AH TP K LVA DSRTVAMEVGIR Sbjct: 9 DAHQTPQKVLVALDSRTVAMEVGIR 33 >SB_30216| Best HMM Match : TIL (HMM E-Value=3.1) Length = 212 Score = 39.9 bits (89), Expect = 0.002 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +1 Query: 613 TAGRWPWKSESAKECAT 663 TAGRWPWK ESAKEC T Sbjct: 1 TAGRWPWKLESAKECVT 17 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/26 (61%), Positives = 17/26 (65%) Frame = +3 Query: 657 CNELHLPKQPALKMDGAETFCLYTTV 734 C HLPKQ ALKMDGA+ LY V Sbjct: 15 CVTTHLPKQLALKMDGAQASHLYRAV 40 >SB_14965| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 295 Score = 39.9 bits (89), Expect = 0.002 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +1 Query: 613 TAGRWPWKSESAKECAT 663 TAGRWPWK ESAKEC T Sbjct: 1 TAGRWPWKLESAKECVT 17 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/26 (61%), Positives = 17/26 (65%) Frame = +3 Query: 657 CNELHLPKQPALKMDGAETFCLYTTV 734 C HLPKQ ALKMDGA+ LY V Sbjct: 15 CVTTHLPKQLALKMDGAQASHLYRAV 40 >SB_6863| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 39.9 bits (89), Expect = 0.002 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +1 Query: 613 TAGRWPWKSESAKECAT 663 TAGRWPWK ESAKEC T Sbjct: 80 TAGRWPWKLESAKECVT 96 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/26 (61%), Positives = 17/26 (65%) Frame = +3 Query: 657 CNELHLPKQPALKMDGAETFCLYTTV 734 C HLPKQ ALKMDGA+ LY V Sbjct: 94 CVTTHLPKQLALKMDGAQASHLYRAV 119 >SB_49647| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 39.9 bits (89), Expect = 0.002 Identities = 19/36 (52%), Positives = 22/36 (61%) Frame = +2 Query: 560 KAPKKRSWDTMKGVGRS*QQDGGHGSRNPLRSVQRT 667 + +RS D KGVG S QQDGGHGS NP + T Sbjct: 10 RCQSRRSSDPTKGVGCSRQQDGGHGSWNPAKECVTT 45 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/26 (61%), Positives = 17/26 (65%) Frame = +3 Query: 657 CNELHLPKQPALKMDGAETFCLYTTV 734 C HLPKQ ALKMDGA+ LY V Sbjct: 42 CVTTHLPKQLALKMDGAQASHLYRAV 67 >SB_6844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 39.1 bits (87), Expect = 0.004 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = -3 Query: 551 FGSSHSASSAYQNWPLGTVIRSPAS 477 FGSS ASSAYQN PLGT I PAS Sbjct: 21 FGSSRIASSAYQNGPLGTRIHCPAS 45 >SB_55300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 35.1 bits (77), Expect = 0.062 Identities = 20/35 (57%), Positives = 21/35 (60%) Frame = +3 Query: 630 MEVGIR*GVCNELHLPKQPALKMDGAETFCLYTTV 734 MEVG C HLPKQ ALKMDGA+ LY V Sbjct: 1 MEVGSA-KECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_53216| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 35.1 bits (77), Expect = 0.062 Identities = 20/35 (57%), Positives = 21/35 (60%) Frame = +3 Query: 630 MEVGIR*GVCNELHLPKQPALKMDGAETFCLYTTV 734 MEVG C HLPKQ ALKMDGA+ LY V Sbjct: 1 MEVGSA-KECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_27787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 35.1 bits (77), Expect = 0.062 Identities = 21/37 (56%), Positives = 22/37 (59%) Frame = +3 Query: 624 VAMEVGIR*GVCNELHLPKQPALKMDGAETFCLYTTV 734 VAMEV C HLPKQ ALKMDGA+ LY V Sbjct: 5 VAMEVESA-KECVTTHLPKQLALKMDGAQASHLYRAV 40 >SB_24856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 35.1 bits (77), Expect = 0.062 Identities = 20/35 (57%), Positives = 21/35 (60%) Frame = +3 Query: 630 MEVGIR*GVCNELHLPKQPALKMDGAETFCLYTTV 734 MEVG C HLPKQ ALKMDGA+ LY V Sbjct: 1 MEVGSA-KECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_16637| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 35.1 bits (77), Expect = 0.062 Identities = 20/35 (57%), Positives = 21/35 (60%) Frame = +3 Query: 630 MEVGIR*GVCNELHLPKQPALKMDGAETFCLYTTV 734 MEVG C HLPKQ ALKMDGA+ LY V Sbjct: 1 MEVGSA-KECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_58055| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/26 (61%), Positives = 17/26 (65%) Frame = +3 Query: 657 CNELHLPKQPALKMDGAETFCLYTTV 734 C HLPKQ ALKMDGA+ LY V Sbjct: 9 CVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_54389| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/26 (61%), Positives = 17/26 (65%) Frame = +3 Query: 657 CNELHLPKQPALKMDGAETFCLYTTV 734 C HLPKQ ALKMDGA+ LY V Sbjct: 9 CVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_53289| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/26 (61%), Positives = 17/26 (65%) Frame = +3 Query: 657 CNELHLPKQPALKMDGAETFCLYTTV 734 C HLPKQ ALKMDGA+ LY V Sbjct: 16 CVTTHLPKQLALKMDGAQASHLYRAV 41 >SB_51835| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/26 (61%), Positives = 17/26 (65%) Frame = +3 Query: 657 CNELHLPKQPALKMDGAETFCLYTTV 734 C HLPKQ ALKMDGA+ LY V Sbjct: 9 CVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_49224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/26 (61%), Positives = 17/26 (65%) Frame = +3 Query: 657 CNELHLPKQPALKMDGAETFCLYTTV 734 C HLPKQ ALKMDGA+ LY V Sbjct: 9 CVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_48809| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/26 (61%), Positives = 17/26 (65%) Frame = +3 Query: 657 CNELHLPKQPALKMDGAETFCLYTTV 734 C HLPKQ ALKMDGA+ LY V Sbjct: 9 CVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_41857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/26 (61%), Positives = 17/26 (65%) Frame = +3 Query: 657 CNELHLPKQPALKMDGAETFCLYTTV 734 C HLPKQ ALKMDGA+ LY V Sbjct: 9 CVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_40886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/26 (61%), Positives = 17/26 (65%) Frame = +3 Query: 657 CNELHLPKQPALKMDGAETFCLYTTV 734 C HLPKQ ALKMDGA+ LY V Sbjct: 9 CVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_40435| Best HMM Match : DUF1677 (HMM E-Value=4.2) Length = 93 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/26 (61%), Positives = 17/26 (65%) Frame = +3 Query: 657 CNELHLPKQPALKMDGAETFCLYTTV 734 C HLPKQ ALKMDGA+ LY V Sbjct: 9 CVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_27353| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/26 (61%), Positives = 17/26 (65%) Frame = +3 Query: 657 CNELHLPKQPALKMDGAETFCLYTTV 734 C HLPKQ ALKMDGA+ LY V Sbjct: 9 CVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_9214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/26 (61%), Positives = 17/26 (65%) Frame = +3 Query: 657 CNELHLPKQPALKMDGAETFCLYTTV 734 C HLPKQ ALKMDGA+ LY V Sbjct: 9 CVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_5959| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/26 (61%), Positives = 17/26 (65%) Frame = +3 Query: 657 CNELHLPKQPALKMDGAETFCLYTTV 734 C HLPKQ ALKMDGA+ LY V Sbjct: 9 CVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_3984| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/26 (61%), Positives = 17/26 (65%) Frame = +3 Query: 657 CNELHLPKQPALKMDGAETFCLYTTV 734 C HLPKQ ALKMDGA+ LY V Sbjct: 9 CVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_47626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/26 (61%), Positives = 17/26 (65%) Frame = +3 Query: 657 CNELHLPKQPALKMDGAETFCLYTTV 734 C HLPKQ ALKMDGA+ LY V Sbjct: 15 CVTTHLPKQLALKMDGAQASHLYRAV 40 >SB_52007| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 33.1 bits (72), Expect = 0.25 Identities = 30/83 (36%), Positives = 37/83 (44%), Gaps = 1/83 (1%) Frame = -2 Query: 723 IGKTFQRHPFSGLVASAGEVRCTLLSGFRLPWPPSCCHERPTPFMVSHERFLGALQYVWF 544 IG T +RHPFSGLVASA E+PTPF+ S ER L L + Sbjct: 24 IGATLERHPFSGLVASA---------------------EQPTPFVGSDERRLWHLNRAFG 62 Query: 543 IPQ-RQFCLPKLATWHRHQISGF 478 + K T + H +SGF Sbjct: 63 SSRIASSAYQKWPTRNSHSLSGF 85 Score = 29.9 bits (64), Expect = 2.3 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -3 Query: 551 FGSSHSASSAYQNWP 507 FGSS ASSAYQ WP Sbjct: 61 FGSSRIASSAYQKWP 75 >SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 33.1 bits (72), Expect = 0.25 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -1 Query: 253 NRYGPPSGFPLTST*PGIVHH 191 NRY PP FPL S GIVHH Sbjct: 1 NRYEPPPEFPLASPYSGIVHH 21 >SB_9493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 33.1 bits (72), Expect = 0.25 Identities = 30/83 (36%), Positives = 37/83 (44%), Gaps = 1/83 (1%) Frame = -2 Query: 723 IGKTFQRHPFSGLVASAGEVRCTLLSGFRLPWPPSCCHERPTPFMVSHERFLGALQYVWF 544 IG T +RHPFSGLVASA E+PTPF+ S ER L L + Sbjct: 22 IGATLERHPFSGLVASA---------------------EQPTPFVGSDERRLWHLNRAFG 60 Query: 543 IPQ-RQFCLPKLATWHRHQISGF 478 + K T + H +SGF Sbjct: 61 SSRIASSAYQKWPTSNSHSLSGF 83 Score = 29.9 bits (64), Expect = 2.3 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -3 Query: 551 FGSSHSASSAYQNWP 507 FGSS ASSAYQ WP Sbjct: 59 FGSSRIASSAYQKWP 73 >SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 32.3 bits (70), Expect = 0.44 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = -3 Query: 302 ISLSPLYPVPTIDLHVES 249 ISLSPLYP TIDLHV S Sbjct: 38 ISLSPLYPNLTIDLHVRS 55 >SB_46486| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=0.7) Length = 703 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/60 (28%), Positives = 32/60 (53%), Gaps = 2/60 (3%) Frame = +1 Query: 160 RSEHKCWDPKD--GELCLVRSKSGETLMEDRSDSTCKSIVGTGYRGERLIEPSSSWFRPK 333 +++ C D ++ GE +KS +T D S ++C+S++ TG + L + S RP+ Sbjct: 303 QNDLSCSDSENEGGESFSTTAKSKDTKANDYSMTSCRSVLATGLNEQSLAKRKESIRRPE 362 >SB_19187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 30.3 bits (65), Expect = 1.8 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = -3 Query: 557 NTFGSSHSASSAYQNWP 507 + FGSS ASSAYQ WP Sbjct: 19 HAFGSSRIASSAYQKWP 35 >SB_40315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 29.9 bits (64), Expect = 2.3 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -3 Query: 551 FGSSHSASSAYQNWP 507 FGSS ASSAYQ WP Sbjct: 58 FGSSRIASSAYQKWP 72 >SB_32500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 29.9 bits (64), Expect = 2.3 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -3 Query: 551 FGSSHSASSAYQNWP 507 FGSS ASSAYQ WP Sbjct: 21 FGSSRIASSAYQKWP 35 >SB_24543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 29.9 bits (64), Expect = 2.3 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -3 Query: 551 FGSSHSASSAYQNWP 507 FGSS ASSAYQ WP Sbjct: 21 FGSSRIASSAYQKWP 35 >SB_20448| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 29.9 bits (64), Expect = 2.3 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -3 Query: 551 FGSSHSASSAYQNWP 507 FGSS ASSAYQ WP Sbjct: 59 FGSSRIASSAYQKWP 73 >SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 29.9 bits (64), Expect = 2.3 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -3 Query: 551 FGSSHSASSAYQNWP 507 FGSS ASSAYQ WP Sbjct: 21 FGSSRIASSAYQKWP 35 >SB_5288| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 29.9 bits (64), Expect = 2.3 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -3 Query: 551 FGSSHSASSAYQNWP 507 FGSS ASSAYQ WP Sbjct: 21 FGSSRIASSAYQKWP 35 >SB_4968| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 29.9 bits (64), Expect = 2.3 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -3 Query: 551 FGSSHSASSAYQNWP 507 FGSS ASSAYQ WP Sbjct: 21 FGSSRIASSAYQKWP 35 >SB_3995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 29.9 bits (64), Expect = 2.3 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -3 Query: 551 FGSSHSASSAYQNWP 507 FGSS ASSAYQ WP Sbjct: 21 FGSSRIASSAYQKWP 35 >SB_1350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 29.9 bits (64), Expect = 2.3 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -3 Query: 551 FGSSHSASSAYQNWP 507 FGSS ASSAYQ WP Sbjct: 21 FGSSRIASSAYQKWP 35 >SB_59236| Best HMM Match : Attractin (HMM E-Value=8.2) Length = 125 Score = 29.9 bits (64), Expect = 2.3 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -3 Query: 551 FGSSHSASSAYQNWP 507 FGSS ASSAYQ WP Sbjct: 100 FGSSRIASSAYQKWP 114 >SB_53668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 29.9 bits (64), Expect = 2.3 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -3 Query: 551 FGSSHSASSAYQNWP 507 FGSS ASSAYQ WP Sbjct: 21 FGSSRIASSAYQKWP 35 >SB_53194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 29.9 bits (64), Expect = 2.3 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -3 Query: 551 FGSSHSASSAYQNWP 507 FGSS ASSAYQ WP Sbjct: 21 FGSSRIASSAYQKWP 35 >SB_47973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 29.9 bits (64), Expect = 2.3 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -3 Query: 551 FGSSHSASSAYQNWP 507 FGSS ASSAYQ WP Sbjct: 21 FGSSRIASSAYQKWP 35 >SB_40285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 29.9 bits (64), Expect = 2.3 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -3 Query: 551 FGSSHSASSAYQNWP 507 FGSS ASSAYQ WP Sbjct: 21 FGSSRIASSAYQKWP 35 >SB_24609| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 29.9 bits (64), Expect = 2.3 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -3 Query: 551 FGSSHSASSAYQNWP 507 FGSS ASSAYQ WP Sbjct: 21 FGSSRIASSAYQKWP 35 >SB_19053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 29.9 bits (64), Expect = 2.3 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -3 Query: 551 FGSSHSASSAYQNWP 507 FGSS ASSAYQ WP Sbjct: 21 FGSSRIASSAYQKWP 35 >SB_16426| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 29.9 bits (64), Expect = 2.3 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -3 Query: 551 FGSSHSASSAYQNWP 507 FGSS ASSAYQ WP Sbjct: 21 FGSSRIASSAYQKWP 35 >SB_15603| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 29.9 bits (64), Expect = 2.3 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -3 Query: 551 FGSSHSASSAYQNWP 507 FGSS ASSAYQ WP Sbjct: 143 FGSSRIASSAYQKWP 157 >SB_24059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 29.5 bits (63), Expect = 3.1 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +1 Query: 634 KSESAKECATNFTCRSNQP*KWMALKRFAYTLP 732 K ESAKEC T + K MALKR YT+P Sbjct: 2 KVESAKECVTTHLPKQLAL-KMMALKRRTYTVP 33 >SB_37973| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 3369 Score = 29.5 bits (63), Expect = 3.1 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = -3 Query: 677 RQVKFVAHSLADSDFHGHRPAVMSDQRLSWCPMSVF 570 + V H + ++DF G R A+M+D +L C S+F Sbjct: 382 KTVILTTHFMDEADFLGDRIAIMADGQLRCCGSSLF 417 >SB_1848| Best HMM Match : Galactosyl_T (HMM E-Value=1.4e-26) Length = 308 Score = 28.7 bits (61), Expect = 5.4 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = +2 Query: 173 NAGTRKMVNYAWSGRSQGKP*WRTVAIRRANRSSE 277 NA RK + + W P WRTV + AN + E Sbjct: 75 NAARRKEIRFTWGTDFLPSPRWRTVFLIGANDNQE 109 >SB_161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 28.7 bits (61), Expect = 5.4 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -3 Query: 551 FGSSHSASSAYQNWP 507 +GSS ASSAYQ WP Sbjct: 21 YGSSRIASSAYQKWP 35 >SB_54195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 370 Score = 28.3 bits (60), Expect = 7.2 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = +2 Query: 173 NAGTRKMVNYAWSGRSQGKP*WRTVAIRRANRSSE 277 NA RK + + W P WRTV + AN + E Sbjct: 79 NAARRKEIRFTWGTDFLPTPRWRTVFLIGANDNQE 113 >SB_29448| Best HMM Match : DnaJ (HMM E-Value=0.00022) Length = 118 Score = 28.3 bits (60), Expect = 7.2 Identities = 16/43 (37%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = -3 Query: 632 HGHRP-AVMSDQRLSWCPMSVF*APYNTFGSSHSASSAYQNWP 507 H R V+ L +C +VF PYN +SH+A A +N P Sbjct: 31 HARRTKVVLEGPLLRYCRQAVFERPYNGRFASHAAFPARRNNP 73 >SB_23401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 380 Score = 28.3 bits (60), Expect = 7.2 Identities = 15/36 (41%), Positives = 21/36 (58%) Frame = -2 Query: 714 TFQRHPFSGLVASAGEVRCTLLSGFRLPWPPSCCHE 607 +F P+S +V + E+ L+SGFRL PP C E Sbjct: 291 SFGAMPYSAVVPN--ELLSMLMSGFRLSRPPLCPEE 324 >SB_13439| Best HMM Match : DnaJ (HMM E-Value=5.9e-24) Length = 565 Score = 28.3 bits (60), Expect = 7.2 Identities = 16/43 (37%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = -3 Query: 632 HGHRP-AVMSDQRLSWCPMSVF*APYNTFGSSHSASSAYQNWP 507 H R V+ L +C +VF PYN +SH+A A +N P Sbjct: 154 HARRTKVVLEGPLLRYCRQAVFERPYNGRFASHAAFPARRNNP 196 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,630,243 Number of Sequences: 59808 Number of extensions: 565087 Number of successful extensions: 1526 Number of sequences better than 10.0: 62 Number of HSP's better than 10.0 without gapping: 1400 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1525 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2070332524 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -