BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30756 (730 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X87410-1|CAA60857.1| 498|Anopheles gambiae maltase-like protein... 62 2e-11 X87411-1|CAA60858.1| 599|Anopheles gambiae maltase-like protein... 59 2e-10 DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. 24 5.5 AY825780-1|AAV70343.1| 147|Anopheles gambiae alanyl-tRNA synthe... 24 5.5 AY825779-1|AAV70342.1| 147|Anopheles gambiae alanyl-tRNA synthe... 24 5.5 AY825778-1|AAV70341.1| 161|Anopheles gambiae alanyl-tRNA synthe... 24 5.5 AY825777-1|AAV70340.1| 161|Anopheles gambiae alanyl-tRNA synthe... 24 5.5 AY825776-1|AAV70339.1| 161|Anopheles gambiae alanyl-tRNA synthe... 24 5.5 AY825775-1|AAV70338.1| 161|Anopheles gambiae alanyl-tRNA synthe... 24 5.5 AY825774-1|AAV70337.1| 160|Anopheles gambiae alanyl-tRNA synthe... 24 5.5 AY825773-1|AAV70336.1| 160|Anopheles gambiae alanyl-tRNA synthe... 24 5.5 AY825772-1|AAV70335.1| 162|Anopheles gambiae alanyl-tRNA synthe... 24 5.5 AY825771-1|AAV70334.1| 162|Anopheles gambiae alanyl-tRNA synthe... 24 5.5 AY825770-1|AAV70333.1| 160|Anopheles gambiae alanyl-tRNA synthe... 24 5.5 AY825769-1|AAV70332.1| 160|Anopheles gambiae alanyl-tRNA synthe... 24 5.5 AY825768-1|AAV70331.1| 160|Anopheles gambiae alanyl-tRNA synthe... 24 5.5 AY825767-1|AAV70330.1| 160|Anopheles gambiae alanyl-tRNA synthe... 24 5.5 AY825766-1|AAV70329.1| 147|Anopheles gambiae alanyl-tRNA synthe... 24 5.5 AY825765-1|AAV70328.1| 147|Anopheles gambiae alanyl-tRNA synthe... 24 5.5 AY825764-1|AAV70327.1| 160|Anopheles gambiae alanyl-tRNA synthe... 24 5.5 AY825763-1|AAV70326.1| 160|Anopheles gambiae alanyl-tRNA synthe... 24 5.5 AY825762-1|AAV70325.1| 146|Anopheles gambiae alanyl-tRNA synthe... 24 5.5 AY825761-1|AAV70324.1| 146|Anopheles gambiae alanyl-tRNA synthe... 24 5.5 AY825760-1|AAV70323.1| 160|Anopheles gambiae alanyl-tRNA synthe... 24 5.5 AY825759-1|AAV70322.1| 160|Anopheles gambiae alanyl-tRNA synthe... 24 5.5 AY825758-1|AAV70321.1| 160|Anopheles gambiae alanyl-tRNA synthe... 24 5.5 AY825757-1|AAV70320.1| 160|Anopheles gambiae alanyl-tRNA synthe... 24 5.5 AY825756-1|AAV70319.1| 160|Anopheles gambiae alanyl-tRNA synthe... 24 5.5 AY825755-1|AAV70318.1| 160|Anopheles gambiae alanyl-tRNA synthe... 24 5.5 AY825754-1|AAV70317.1| 160|Anopheles gambiae alanyl-tRNA synthe... 24 5.5 AY825753-1|AAV70316.1| 160|Anopheles gambiae alanyl-tRNA synthe... 24 5.5 AY825750-1|AAV70313.1| 130|Anopheles gambiae alanyl-tRNA synthe... 24 5.5 AY825749-1|AAV70312.1| 130|Anopheles gambiae alanyl-tRNA synthe... 24 5.5 AY825748-1|AAV70311.1| 160|Anopheles gambiae alanyl-tRNA synthe... 24 5.5 AY825747-1|AAV70310.1| 160|Anopheles gambiae alanyl-tRNA synthe... 24 5.5 AY825746-1|AAV70309.1| 160|Anopheles gambiae alanyl-tRNA synthe... 24 5.5 AY825745-1|AAV70308.1| 160|Anopheles gambiae alanyl-tRNA synthe... 24 5.5 AY825744-1|AAV70307.1| 160|Anopheles gambiae alanyl-tRNA synthe... 24 5.5 AY825743-1|AAV70306.1| 160|Anopheles gambiae alanyl-tRNA synthe... 24 5.5 AY825742-1|AAV70305.1| 160|Anopheles gambiae alanyl-tRNA synthe... 24 5.5 AY825741-1|AAV70304.1| 160|Anopheles gambiae alanyl-tRNA synthe... 24 5.5 AY825740-1|AAV70303.1| 161|Anopheles gambiae alanyl-tRNA synthe... 24 5.5 AY825739-1|AAV70302.1| 161|Anopheles gambiae alanyl-tRNA synthe... 24 5.5 AY825738-1|AAV70301.1| 160|Anopheles gambiae alanyl-tRNA synthe... 24 5.5 AY825737-1|AAV70300.1| 160|Anopheles gambiae alanyl-tRNA synthe... 24 5.5 AY825736-1|AAV70299.1| 161|Anopheles gambiae alanyl-tRNA synthe... 24 5.5 AY825735-1|AAV70298.1| 161|Anopheles gambiae alanyl-tRNA synthe... 24 5.5 AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 23 9.7 >X87410-1|CAA60857.1| 498|Anopheles gambiae maltase-like protein Agm1 protein. Length = 498 Score = 62.1 bits (144), Expect = 2e-11 Identities = 29/80 (36%), Positives = 45/80 (56%) Frame = +3 Query: 246 LFHWTKEQPANWVSKINTPAFTRSDKRQMFYLHQFCDNCADLNFDNPKVVEKFDMVLKAW 425 L + T+ P+NWVS A+ +D R+ +YLHQF DLN+ NP +V++ V+ W Sbjct: 152 LANGTRVPPSNWVSVFRGSAWEWNDVRKEYYLHQFLVKQPDLNYRNPALVQEMKDVMTFW 211 Query: 426 MGAGASGVRLNNARHLLVEL 485 +G G G R++ +L L Sbjct: 212 LGKGVHGFRIDAVPYLFESL 231 Score = 36.7 bits (81), Expect = 7e-04 Identities = 16/61 (26%), Positives = 31/61 (50%), Gaps = 1/61 (1%) Frame = +1 Query: 76 ADLRMLDKR-DTLDEFKILFNKIKKIGVRVIVDLIPNYVFTNHTWFVQSENSTEPYTDYF 252 AD R + T+ + + L G+++I+D +PN+ WF++S Y+DY+ Sbjct: 85 ADFRDIHSEFGTIADLEALATACNAEGLKLILDFVPNHSSDESEWFLKSVQKDPTYSDYY 144 Query: 253 I 255 + Sbjct: 145 V 145 Score = 27.9 bits (59), Expect = 0.34 Identities = 13/48 (27%), Positives = 25/48 (52%) Frame = +2 Query: 497 DARRRGSSVDADHMRYDFWEHKHTTDLPKLKELLARWSKIVTKESEPT 640 D + G + D D+ Y H+HT +L + +++ +W K+V + T Sbjct: 239 DEEKSGETDDPDNPTY--LVHQHTQNLDETFDMMYQWRKVVDDFKQQT 284 >X87411-1|CAA60858.1| 599|Anopheles gambiae maltase-like protein Agm2 protein. Length = 599 Score = 58.8 bits (136), Expect = 2e-10 Identities = 26/66 (39%), Positives = 39/66 (59%) Frame = +3 Query: 261 KEQPANWVSKINTPAFTRSDKRQMFYLHQFCDNCADLNFDNPKVVEKFDMVLKAWMGAGA 440 ++ P NWV+ A+ +D+R+ FYLHQF DLN+ NP VV+ VL+ W+ G Sbjct: 154 RDPPNNWVAAWYGSAWEWNDERKQFYLHQFHKKQPDLNYRNPAVVQAMKDVLRFWLDQGV 213 Query: 441 SGVRLN 458 G R++ Sbjct: 214 DGFRID 219 Score = 48.4 bits (110), Expect = 2e-07 Identities = 19/50 (38%), Positives = 30/50 (60%) Frame = +1 Query: 106 TLDEFKILFNKIKKIGVRVIVDLIPNYVFTNHTWFVQSENSTEPYTDYFI 255 TL +FK L + KK+ +R+I+D +PN+ H WF +S Y DY++ Sbjct: 95 TLADFKQLVEEAKKLQLRIILDFVPNHSSDEHEWFKKSVQRVSGYEDYYV 144 >DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. Length = 889 Score = 23.8 bits (49), Expect = 5.5 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = -3 Query: 716 GPQASTRCGSAVSGPAGSHLP 654 GP S G + GPAGS P Sbjct: 592 GPPPSPLAGGPLGGPAGSRPP 612 >AY825780-1|AAV70343.1| 147|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 147 Score = 23.8 bits (49), Expect = 5.5 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +2 Query: 491 GEDARRRGSSVDADHMRYDF 550 G+D +RGS V + +R+DF Sbjct: 122 GQDTDQRGSLVVPEKLRFDF 141 >AY825779-1|AAV70342.1| 147|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 147 Score = 23.8 bits (49), Expect = 5.5 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +2 Query: 491 GEDARRRGSSVDADHMRYDF 550 G+D +RGS V + +R+DF Sbjct: 122 GQDTDQRGSLVVPEKLRFDF 141 >AY825778-1|AAV70341.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 23.8 bits (49), Expect = 5.5 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +2 Query: 491 GEDARRRGSSVDADHMRYDF 550 G+D +RGS V + +R+DF Sbjct: 136 GQDTDQRGSLVVPEKLRFDF 155 >AY825777-1|AAV70340.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 23.8 bits (49), Expect = 5.5 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +2 Query: 491 GEDARRRGSSVDADHMRYDF 550 G+D +RGS V + +R+DF Sbjct: 136 GQDTDQRGSLVVPEKLRFDF 155 >AY825776-1|AAV70339.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 23.8 bits (49), Expect = 5.5 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +2 Query: 491 GEDARRRGSSVDADHMRYDF 550 G+D +RGS V + +R+DF Sbjct: 136 GQDTDQRGSLVVPEKLRFDF 155 >AY825775-1|AAV70338.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 23.8 bits (49), Expect = 5.5 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +2 Query: 491 GEDARRRGSSVDADHMRYDF 550 G+D +RGS V + +R+DF Sbjct: 136 GQDTDQRGSLVVPEKLRFDF 155 >AY825774-1|AAV70337.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.8 bits (49), Expect = 5.5 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +2 Query: 491 GEDARRRGSSVDADHMRYDF 550 G+D +RGS V + +R+DF Sbjct: 136 GQDTDQRGSLVVPEKLRFDF 155 >AY825773-1|AAV70336.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.8 bits (49), Expect = 5.5 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +2 Query: 491 GEDARRRGSSVDADHMRYDF 550 G+D +RGS V + +R+DF Sbjct: 136 GQDTDQRGSLVVPEKLRFDF 155 >AY825772-1|AAV70335.1| 162|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 162 Score = 23.8 bits (49), Expect = 5.5 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +2 Query: 491 GEDARRRGSSVDADHMRYDF 550 G+D +RGS V + +R+DF Sbjct: 136 GQDTDQRGSLVVPEKLRFDF 155 >AY825771-1|AAV70334.1| 162|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 162 Score = 23.8 bits (49), Expect = 5.5 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +2 Query: 491 GEDARRRGSSVDADHMRYDF 550 G+D +RGS V + +R+DF Sbjct: 136 GQDTDQRGSLVVPEKLRFDF 155 >AY825770-1|AAV70333.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.8 bits (49), Expect = 5.5 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +2 Query: 491 GEDARRRGSSVDADHMRYDF 550 G+D +RGS V + +R+DF Sbjct: 136 GQDTDQRGSLVVPEKLRFDF 155 >AY825769-1|AAV70332.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.8 bits (49), Expect = 5.5 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +2 Query: 491 GEDARRRGSSVDADHMRYDF 550 G+D +RGS V + +R+DF Sbjct: 136 GQDTDQRGSLVVPEKLRFDF 155 >AY825768-1|AAV70331.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.8 bits (49), Expect = 5.5 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +2 Query: 491 GEDARRRGSSVDADHMRYDF 550 G+D +RGS V + +R+DF Sbjct: 136 GQDTDQRGSLVVPEKLRFDF 155 >AY825767-1|AAV70330.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.8 bits (49), Expect = 5.5 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +2 Query: 491 GEDARRRGSSVDADHMRYDF 550 G+D +RGS V + +R+DF Sbjct: 136 GQDTDQRGSLVVPEKLRFDF 155 >AY825766-1|AAV70329.1| 147|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 147 Score = 23.8 bits (49), Expect = 5.5 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +2 Query: 491 GEDARRRGSSVDADHMRYDF 550 G+D +RGS V + +R+DF Sbjct: 123 GQDTDQRGSLVVPEKLRFDF 142 >AY825765-1|AAV70328.1| 147|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 147 Score = 23.8 bits (49), Expect = 5.5 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +2 Query: 491 GEDARRRGSSVDADHMRYDF 550 G+D +RGS V + +R+DF Sbjct: 123 GQDTDQRGSLVVPEKLRFDF 142 >AY825764-1|AAV70327.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.8 bits (49), Expect = 5.5 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +2 Query: 491 GEDARRRGSSVDADHMRYDF 550 G+D +RGS V + +R+DF Sbjct: 136 GQDTDQRGSLVVPEKLRFDF 155 >AY825763-1|AAV70326.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.8 bits (49), Expect = 5.5 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +2 Query: 491 GEDARRRGSSVDADHMRYDF 550 G+D +RGS V + +R+DF Sbjct: 136 GQDTDQRGSLVVPEKLRFDF 155 >AY825762-1|AAV70325.1| 146|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 146 Score = 23.8 bits (49), Expect = 5.5 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +2 Query: 491 GEDARRRGSSVDADHMRYDF 550 G+D +RGS V + +R+DF Sbjct: 122 GQDTDQRGSLVVPEKLRFDF 141 >AY825761-1|AAV70324.1| 146|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 146 Score = 23.8 bits (49), Expect = 5.5 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +2 Query: 491 GEDARRRGSSVDADHMRYDF 550 G+D +RGS V + +R+DF Sbjct: 122 GQDTDQRGSLVVPEKLRFDF 141 >AY825760-1|AAV70323.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.8 bits (49), Expect = 5.5 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +2 Query: 491 GEDARRRGSSVDADHMRYDF 550 G+D +RGS V + +R+DF Sbjct: 136 GQDTDQRGSLVVPEKLRFDF 155 >AY825759-1|AAV70322.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.8 bits (49), Expect = 5.5 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +2 Query: 491 GEDARRRGSSVDADHMRYDF 550 G+D +RGS V + +R+DF Sbjct: 136 GQDTDQRGSLVVPEKLRFDF 155 >AY825758-1|AAV70321.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.8 bits (49), Expect = 5.5 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +2 Query: 491 GEDARRRGSSVDADHMRYDF 550 G+D +RGS V + +R+DF Sbjct: 136 GQDTDQRGSLVVPEKLRFDF 155 >AY825757-1|AAV70320.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.8 bits (49), Expect = 5.5 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +2 Query: 491 GEDARRRGSSVDADHMRYDF 550 G+D +RGS V + +R+DF Sbjct: 136 GQDTDQRGSLVVPEKLRFDF 155 >AY825756-1|AAV70319.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.8 bits (49), Expect = 5.5 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +2 Query: 491 GEDARRRGSSVDADHMRYDF 550 G+D +RGS V + +R+DF Sbjct: 136 GQDTDQRGSLVVPEKLRFDF 155 >AY825755-1|AAV70318.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.8 bits (49), Expect = 5.5 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +2 Query: 491 GEDARRRGSSVDADHMRYDF 550 G+D +RGS V + +R+DF Sbjct: 136 GQDTDQRGSLVVPEKLRFDF 155 >AY825754-1|AAV70317.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.8 bits (49), Expect = 5.5 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +2 Query: 491 GEDARRRGSSVDADHMRYDF 550 G+D +RGS V + +R+DF Sbjct: 136 GQDTDQRGSLVVPEKLRFDF 155 >AY825753-1|AAV70316.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.8 bits (49), Expect = 5.5 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +2 Query: 491 GEDARRRGSSVDADHMRYDF 550 G+D +RGS V + +R+DF Sbjct: 136 GQDTDQRGSLVVPEKLRFDF 155 >AY825750-1|AAV70313.1| 130|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 130 Score = 23.8 bits (49), Expect = 5.5 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +2 Query: 491 GEDARRRGSSVDADHMRYDF 550 G+D +RGS V + +R+DF Sbjct: 106 GQDTDQRGSLVVPEKLRFDF 125 >AY825749-1|AAV70312.1| 130|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 130 Score = 23.8 bits (49), Expect = 5.5 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +2 Query: 491 GEDARRRGSSVDADHMRYDF 550 G+D +RGS V + +R+DF Sbjct: 106 GQDTDQRGSLVVPEKLRFDF 125 >AY825748-1|AAV70311.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.8 bits (49), Expect = 5.5 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +2 Query: 491 GEDARRRGSSVDADHMRYDF 550 G+D +RGS V + +R+DF Sbjct: 136 GQDTDQRGSLVVPEKLRFDF 155 >AY825747-1|AAV70310.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.8 bits (49), Expect = 5.5 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +2 Query: 491 GEDARRRGSSVDADHMRYDF 550 G+D +RGS V + +R+DF Sbjct: 136 GQDTDQRGSLVVPEKLRFDF 155 >AY825746-1|AAV70309.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.8 bits (49), Expect = 5.5 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +2 Query: 491 GEDARRRGSSVDADHMRYDF 550 G+D +RGS V + +R+DF Sbjct: 136 GQDTDQRGSLVVPEKLRFDF 155 >AY825745-1|AAV70308.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.8 bits (49), Expect = 5.5 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +2 Query: 491 GEDARRRGSSVDADHMRYDF 550 G+D +RGS V + +R+DF Sbjct: 136 GQDTDQRGSLVVPEKLRFDF 155 >AY825744-1|AAV70307.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.8 bits (49), Expect = 5.5 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +2 Query: 491 GEDARRRGSSVDADHMRYDF 550 G+D +RGS V + +R+DF Sbjct: 136 GQDTDQRGSLVVPEKLRFDF 155 >AY825743-1|AAV70306.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.8 bits (49), Expect = 5.5 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +2 Query: 491 GEDARRRGSSVDADHMRYDF 550 G+D +RGS V + +R+DF Sbjct: 136 GQDTDQRGSLVVPEKLRFDF 155 >AY825742-1|AAV70305.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.8 bits (49), Expect = 5.5 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +2 Query: 491 GEDARRRGSSVDADHMRYDF 550 G+D +RGS V + +R+DF Sbjct: 136 GQDTDQRGSLVVPEKLRFDF 155 >AY825741-1|AAV70304.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.8 bits (49), Expect = 5.5 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +2 Query: 491 GEDARRRGSSVDADHMRYDF 550 G+D +RGS V + +R+DF Sbjct: 136 GQDTDQRGSLVVPEKLRFDF 155 >AY825740-1|AAV70303.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 23.8 bits (49), Expect = 5.5 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +2 Query: 491 GEDARRRGSSVDADHMRYDF 550 G+D +RGS V + +R+DF Sbjct: 136 GQDTDQRGSLVVPEKLRFDF 155 >AY825739-1|AAV70302.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 23.8 bits (49), Expect = 5.5 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +2 Query: 491 GEDARRRGSSVDADHMRYDF 550 G+D +RGS V + +R+DF Sbjct: 136 GQDTDQRGSLVVPEKLRFDF 155 >AY825738-1|AAV70301.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.8 bits (49), Expect = 5.5 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +2 Query: 491 GEDARRRGSSVDADHMRYDF 550 G+D +RGS V + +R+DF Sbjct: 136 GQDTDQRGSLVVPEKLRFDF 155 >AY825737-1|AAV70300.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.8 bits (49), Expect = 5.5 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +2 Query: 491 GEDARRRGSSVDADHMRYDF 550 G+D +RGS V + +R+DF Sbjct: 136 GQDTDQRGSLVVPEKLRFDF 155 >AY825736-1|AAV70299.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 23.8 bits (49), Expect = 5.5 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +2 Query: 491 GEDARRRGSSVDADHMRYDF 550 G+D +RGS V + +R+DF Sbjct: 136 GQDTDQRGSLVVPEKLRFDF 155 >AY825735-1|AAV70298.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 23.8 bits (49), Expect = 5.5 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +2 Query: 491 GEDARRRGSSVDADHMRYDF 550 G+D +RGS V + +R+DF Sbjct: 136 GQDTDQRGSLVVPEKLRFDF 155 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 23.0 bits (47), Expect = 9.7 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +3 Query: 336 YLHQFCDNCADLNFDNP 386 YL QFC++CA NP Sbjct: 699 YLGQFCESCAPGYRHNP 715 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 700,475 Number of Sequences: 2352 Number of extensions: 14307 Number of successful extensions: 74 Number of sequences better than 10.0: 48 Number of HSP's better than 10.0 without gapping: 69 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 74 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74428737 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -