BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30753 (729 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprol... 24 4.2 M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles ... 23 7.3 M93689-1|AAA29368.1| 442|Anopheles gambiae protein ( Anopheles ... 23 7.3 AY176049-1|AAO19580.1| 515|Anopheles gambiae cytochrome P450 CY... 23 9.7 AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 23 9.7 AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22... 23 9.7 >AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprolinase protein. Length = 1344 Score = 24.2 bits (50), Expect = 4.2 Identities = 17/54 (31%), Positives = 24/54 (44%) Frame = -1 Query: 669 PRAFWLKAPTCCLRAIQKMGTKATAAGL*PIFLMYEDTSFLISSNLGSLYGGSV 508 PRA L A CLR + L PI ++ S L S+ ++ GG+V Sbjct: 1057 PRAITLSALIYCLRCMVGHDVPLNQGCLAPIEVIIPPGSILDPSDGAAVVGGNV 1110 >M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 975 Score = 23.4 bits (48), Expect = 7.3 Identities = 9/31 (29%), Positives = 16/31 (51%) Frame = +2 Query: 515 PPYSEPRFEEIKKEVSSYIKKIGYNPAAVAF 607 PP+S +KK+ Y+++ N +A F Sbjct: 333 PPWSNRTLRNLKKDRMKYLRRYRLNRSAFNF 363 >M93689-1|AAA29368.1| 442|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 442 Score = 23.4 bits (48), Expect = 7.3 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = +2 Query: 452 ARFHPRCQTAHRRSKQNGFTEPPYS 526 ARF P T+HR S N + P S Sbjct: 344 ARFDPSALTSHRSSSANCSSAAPKS 368 >AY176049-1|AAO19580.1| 515|Anopheles gambiae cytochrome P450 CYP12F3 protein. Length = 515 Score = 23.0 bits (47), Expect = 9.7 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +3 Query: 270 WKFETSKYYVTIIDAPG 320 W +E K+ T+I+ PG Sbjct: 487 WNYEDYKFRTTVINMPG 503 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 23.0 bits (47), Expect = 9.7 Identities = 13/51 (25%), Positives = 27/51 (52%), Gaps = 4/51 (7%) Frame = +3 Query: 507 SLNHHTVSPDLRKSRRK----YPHTSRRLATTQLLSLSCPFSGWHGDNMLE 647 +L+HH + PD+ K+ + + T AT +L+++S + G N+ + Sbjct: 826 ALDHHDMDPDMEKALKSGNYFFTATFAIEATMKLIAMSPKYYFQEGWNIFD 876 >AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22D protein. Length = 1322 Score = 23.0 bits (47), Expect = 9.7 Identities = 16/41 (39%), Positives = 18/41 (43%) Frame = -3 Query: 472 TPRVKASKACSRV*PFLEIPASNSPVPAATMSTAQSA*EVP 350 T R AS S P IPA + PVPA QS +P Sbjct: 354 TSRPVASGPTSHYYPS-HIPAGSQPVPAVVNPHQQSRPTIP 393 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 802,799 Number of Sequences: 2352 Number of extensions: 17290 Number of successful extensions: 36 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 35 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 36 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74428737 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -