BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30749 (796 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC25H2.08c |mrs2||magnesium ion transporter Mrs2|Schizosacchar... 29 0.58 SPAC3F10.06c |||initiator methionine tRNA 2'-O-ribosyl phosphate... 26 7.1 >SPBC25H2.08c |mrs2||magnesium ion transporter Mrs2|Schizosaccharomyces pombe|chr 2|||Manual Length = 422 Score = 29.5 bits (63), Expect = 0.58 Identities = 14/27 (51%), Positives = 17/27 (62%) Frame = -3 Query: 344 MISLFGTFLRDPIPEFARICRSLKLFP 264 M+ + G LR I F+ ICRSL LFP Sbjct: 1 MVLIVGFNLRTSIASFSPICRSLFLFP 27 >SPAC3F10.06c |||initiator methionine tRNA 2'-O-ribosyl phosphate transferase |Schizosaccharomyces pombe|chr 1|||Manual Length = 453 Score = 25.8 bits (54), Expect = 7.1 Identities = 12/36 (33%), Positives = 21/36 (58%) Frame = -3 Query: 428 INYILAKVQHSQNRHLQICHDTKY*STMMISLFGTF 321 + I + +H +NR L I HD K+ +++ S + TF Sbjct: 10 VQQIHVQARHPKNRLLSIAHDAKFVDSVIAS-YPTF 44 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,861,418 Number of Sequences: 5004 Number of extensions: 53425 Number of successful extensions: 109 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 105 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 109 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 387388442 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -