BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30749 (796 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_01_0196 + 1559190-1560395 29 5.6 01_06_0063 + 26100877-26101144,26101683-26101990,26102133-261028... 28 9.8 >03_01_0196 + 1559190-1560395 Length = 401 Score = 28.7 bits (61), Expect = 5.6 Identities = 15/32 (46%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = +2 Query: 50 IVGMLKLHALRPYSPRPTL-AYSNACNTCFRT 142 +V +LK HAL Y+P+PTL S A T T Sbjct: 248 LVTLLKYHALPSYNPKPTLKTVSRAMRTLAST 279 >01_06_0063 + 26100877-26101144,26101683-26101990,26102133-26102849, 26103338-26103466,26103594-26103698,26103732-26103797, 26104102-26104302,26104437-26104562 Length = 639 Score = 27.9 bits (59), Expect = 9.8 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = +2 Query: 92 PRPTLAYSNACNTCFRTPEISFTFHYSNYTRSIHSELER 208 P LAY NA C++TP + Y+RS SE +R Sbjct: 190 PESILAYKNAYPGCYKTPRSPTPYSGKFYSRS-DSETKR 227 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,123,640 Number of Sequences: 37544 Number of extensions: 274660 Number of successful extensions: 461 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 453 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 461 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2150667972 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -