BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30749 (796 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81454-8|CAD60404.1| 330|Caenorhabditis elegans Hypothetical pr... 30 1.7 U50300-5|AAC48103.2| 337|Caenorhabditis elegans Serpentine rece... 30 2.2 U00054-3|AAM48546.1| 12268|Caenorhabditis elegans Hypothetical p... 29 3.8 >Z81454-8|CAD60404.1| 330|Caenorhabditis elegans Hypothetical protein B0391.12 protein. Length = 330 Score = 30.3 bits (65), Expect = 1.7 Identities = 18/52 (34%), Positives = 27/52 (51%) Frame = +2 Query: 134 FRTPEISFTFHYSNYTRSIHSELERLLINMACLYSHYCRHYIIRGIVLMSDI 289 FR P+ + FHY N+ I +LIN++ L YC + I + I +S I Sbjct: 182 FRFPDENGGFHY-NWNSFIALSFMLILINLSFLTVFYCGYRIYKTINTLSSI 232 >U50300-5|AAC48103.2| 337|Caenorhabditis elegans Serpentine receptor, class t protein18 protein. Length = 337 Score = 29.9 bits (64), Expect = 2.2 Identities = 12/35 (34%), Positives = 21/35 (60%) Frame = +3 Query: 528 YILIIAERLSVNLSTKRITKYYCVSFPEAFIYCYF 632 Y++ I + S STK++TK +AF++C+F Sbjct: 234 YLVWIYLKKSTQSSTKKLTKMQATVLLQAFLFCFF 268 >U00054-3|AAM48546.1| 12268|Caenorhabditis elegans Hypothetical protein K07E12.1b protein. Length = 12268 Score = 29.1 bits (62), Expect = 3.8 Identities = 11/31 (35%), Positives = 22/31 (70%) Frame = +2 Query: 110 YSNACNTCFRTPEISFTFHYSNYTRSIHSEL 202 YS++ + F+ P S TFH+S++T S++ ++ Sbjct: 12237 YSSSYSYIFQNPPKSVTFHHSSFTFSLNPKI 12267 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,294,089 Number of Sequences: 27780 Number of extensions: 285370 Number of successful extensions: 619 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 608 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 619 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1935274832 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -