BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30747 (397 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X87410-1|CAA60857.1| 498|Anopheles gambiae maltase-like protein... 23 4.1 DQ396551-1|ABD60146.1| 354|Anopheles gambiae adipokinetic hormo... 23 4.1 AY705396-1|AAU12505.1| 710|Anopheles gambiae nicotinic acetylch... 22 9.4 AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/T... 22 9.4 AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/T... 22 9.4 >X87410-1|CAA60857.1| 498|Anopheles gambiae maltase-like protein Agm1 protein. Length = 498 Score = 23.0 bits (47), Expect = 4.1 Identities = 9/35 (25%), Positives = 19/35 (54%) Frame = +3 Query: 75 NFKETHYKKYRPACQTQCTYYKFRTIFRRKQTVTR 179 N+K +YK + A ++ +K R+++T+ R Sbjct: 455 NYKTLNYKAQKAAARSHVKIFKALVRLRKQRTLRR 489 >DQ396551-1|ABD60146.1| 354|Anopheles gambiae adipokinetic hormone receptor protein. Length = 354 Score = 23.0 bits (47), Expect = 4.1 Identities = 8/22 (36%), Positives = 15/22 (68%) Frame = +1 Query: 79 LKKLTTKNIDQHVKHNVLIISS 144 L K +TKN+DQ ++ + + +S Sbjct: 293 LDKESTKNVDQRIQKGLFLFAS 314 >AY705396-1|AAU12505.1| 710|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 3 protein. Length = 710 Score = 21.8 bits (44), Expect = 9.4 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +3 Query: 297 HFRSPQKHFRNP 332 HFRSPQ H P Sbjct: 327 HFRSPQTHTMAP 338 >AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1977 Score = 21.8 bits (44), Expect = 9.4 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = +1 Query: 274 KNNELLKSTSDLPKSTFEIPKSSFETETYIRRGDEERRTKT 396 K+ +LLK+ SD SF+ T + GD RRT+T Sbjct: 256 KDEQLLKALSDA---------CSFDRGTQDKAGDGTRRTRT 287 >AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1978 Score = 21.8 bits (44), Expect = 9.4 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = +1 Query: 274 KNNELLKSTSDLPKSTFEIPKSSFETETYIRRGDEERRTKT 396 K+ +LLK+ SD SF+ T + GD RRT+T Sbjct: 256 KDEQLLKALSDA---------CSFDRGTQDKAGDGTRRTRT 287 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 356,561 Number of Sequences: 2352 Number of extensions: 6322 Number of successful extensions: 13 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 31212099 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -