BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30747 (397 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE014134-2240|AAF53222.3| 1334|Drosophila melanogaster CG5792-PB... 29 1.7 BT024943-1|ABE01173.1| 1116|Drosophila melanogaster IP16022p pro... 29 3.0 >AE014134-2240|AAF53222.3| 1334|Drosophila melanogaster CG5792-PB, isoform B protein. Length = 1334 Score = 29.5 bits (63), Expect = 1.7 Identities = 16/45 (35%), Positives = 25/45 (55%) Frame = +3 Query: 231 SNKQSNYEKRKINLKE*RTPQKHFRSPQKHFRNPQKFIRNRNLYQ 365 SN+Q N ++ I+ + P+ FRSP+ H + P + RN N Q Sbjct: 426 SNQQPNLDRNAISDDGIQLPRDRFRSPEAHPKQP-PYPRNVNADQ 469 >BT024943-1|ABE01173.1| 1116|Drosophila melanogaster IP16022p protein. Length = 1116 Score = 28.7 bits (61), Expect = 3.0 Identities = 16/45 (35%), Positives = 25/45 (55%) Frame = +3 Query: 231 SNKQSNYEKRKINLKE*RTPQKHFRSPQKHFRNPQKFIRNRNLYQ 365 SN+Q+N + I+ + P+ FRSP+ H + P + RN N Q Sbjct: 447 SNQQTNLDLNAISDDGIQLPRDRFRSPEAHPKQP-PYPRNVNADQ 490 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,734,438 Number of Sequences: 53049 Number of extensions: 252535 Number of successful extensions: 663 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 645 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 663 length of database: 24,988,368 effective HSP length: 77 effective length of database: 20,903,595 effective search space used: 1128794130 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -