BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30745 (641 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q1MP29 Cluster: NA; n=1; Lawsonia intracellularis PHE/M... 33 4.4 >UniRef50_Q1MP29 Cluster: NA; n=1; Lawsonia intracellularis PHE/MN1-00|Rep: NA - Lawsonia intracellularis (strain PHE/MN1-00) Length = 653 Score = 33.5 bits (73), Expect = 4.4 Identities = 20/79 (25%), Positives = 39/79 (49%), Gaps = 2/79 (2%) Frame = +3 Query: 156 FKLQV*TLLWFYCHYFFNNRFRQ--GYSL*TSNIKTNNINLFSI*LQTLTINKRVYTYAC 329 F L + + L ++C+Y FNN F Q ++ T+N + SI + I +Y ++ Sbjct: 46 FPLSIFSTLIYFCYYKFNNIFIQIKQHTDTTNNFIQDENKYISIMISIACIIMFIYFFSK 105 Query: 330 VCVKYMVLCEMFFFINIIY 386 + +LC +F +++ Y Sbjct: 106 SYLLTWILCVIFLLVSLFY 124 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 624,877,527 Number of Sequences: 1657284 Number of extensions: 12535985 Number of successful extensions: 24555 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 23366 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24502 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 48126133708 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -