BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30744 (603 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_01_0341 + 2543845-2543916,2543987-2544199,2544293-2544370,254... 29 2.1 02_02_0223 - 8021040-8021247,8022275-8022367,8022808-8023059,802... 29 3.7 11_06_0762 + 27043460-27044319,27052096-27052912,27052992-270536... 28 6.5 >11_01_0341 + 2543845-2543916,2543987-2544199,2544293-2544370, 2544480-2544545,2544707-2544805 Length = 175 Score = 29.5 bits (63), Expect = 2.1 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = -3 Query: 247 AKPPPRSTAEAAGAQTARGE 188 A PPP +T EAA A A+GE Sbjct: 16 ASPPPHATQEAAAAAVAKGE 35 >02_02_0223 - 8021040-8021247,8022275-8022367,8022808-8023059, 8023143-8023597,8023667-8023983,8024019-8024298, 8024423-8024728,8024762-8025130,8025216-8025455 Length = 839 Score = 28.7 bits (61), Expect = 3.7 Identities = 15/45 (33%), Positives = 23/45 (51%) Frame = +2 Query: 464 PSPRSTTKSSFIKAPLLPAPVRNHYPRSSPKNEEQTLVYVFGSRK 598 P P S K P +P +R+H +S +N+E+ +V VF K Sbjct: 503 PEPEIFEDPSPAKDPEVPRVLRSHDSKSKDENKEKFMVTVFRGGK 547 >11_06_0762 + 27043460-27044319,27052096-27052912,27052992-27053649, 27053698-27053934,27054091-27054161,27054346-27054441 Length = 912 Score = 27.9 bits (59), Expect = 6.5 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 48 LRHSARPDPRRDTLTMRREGPA*EDT 125 LRH + PRR T+T+ R+G DT Sbjct: 834 LRHLTKKHPRRPTITLIRDGEEPTDT 859 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,638,320 Number of Sequences: 37544 Number of extensions: 208626 Number of successful extensions: 784 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 763 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 784 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1431112012 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -