BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30736 (729 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z66562-4|CAA91465.1| 258|Caenorhabditis elegans Hypothetical pr... 29 2.6 Z82274-7|CAD21646.1| 331|Caenorhabditis elegans Hypothetical pr... 28 7.9 >Z66562-4|CAA91465.1| 258|Caenorhabditis elegans Hypothetical protein F42E11.3 protein. Length = 258 Score = 29.5 bits (63), Expect = 2.6 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = -2 Query: 428 KFALFFCRMVVLDTLPLFWAVASRYLNFQI 339 KF + C +V +PL+W V S +L QI Sbjct: 99 KFVISICDRLVTAQMPLYWFVVSAFLIIQI 128 >Z82274-7|CAD21646.1| 331|Caenorhabditis elegans Hypothetical protein JC8.13 protein. Length = 331 Score = 27.9 bits (59), Expect = 7.9 Identities = 16/58 (27%), Positives = 30/58 (51%), Gaps = 2/58 (3%) Frame = -2 Query: 347 FQITLHSTTIVVKPSLSRSFFFSQTKVIN*IITVIYLLR--LTYTLFSILIIVVEKHF 180 F+ +ST I+ P +S FFF Q + I+ +YL R L + F+++ ++ + Sbjct: 169 FEEVSNSTDIIPNPLISACFFFRQLHRKSSILHDLYLFRRKLPHESFNLIQSIISSFY 226 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,955,102 Number of Sequences: 27780 Number of extensions: 319131 Number of successful extensions: 615 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 608 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 615 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1718929214 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -