BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30735 (625 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nu... 24 0.90 AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. 22 3.6 AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 21 8.4 >AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nuclear receptor protein. Length = 407 Score = 24.2 bits (50), Expect = 0.90 Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 2/34 (5%) Frame = -3 Query: 422 GDMRSPSGCTCRTSSQSPVPA--PIAALQGLAAV 327 G + SPSG T SS SP P P++ + L ++ Sbjct: 55 GSLLSPSGNTPNKSSTSPYPPNHPLSGSKHLCSI 88 >AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. Length = 556 Score = 22.2 bits (45), Expect = 3.6 Identities = 14/44 (31%), Positives = 17/44 (38%) Frame = -1 Query: 298 CSMVYLENYNEFKFTFPIQVRVFSLIRSSHAFSCFHILNTLSIN 167 C V+LE KFT P+ V I A S I+ N Sbjct: 207 CFQVFLEGERRGKFTVPLTPVVSEPIYDKKAMSDLMIVKLSHCN 250 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 21.0 bits (42), Expect = 8.4 Identities = 6/13 (46%), Positives = 10/13 (76%) Frame = -1 Query: 592 VCGPLVRIFGFPL 554 +CG + +FGFP+ Sbjct: 245 MCGAINMLFGFPI 257 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 154,972 Number of Sequences: 336 Number of extensions: 3480 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15979473 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -