BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30732 (679 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g62440.1 68416.m07014 F-box family protein contains F-box dom... 29 2.1 At1g34500.1 68414.m04288 membrane bound O-acyl transferase (MBOA... 27 8.6 >At3g62440.1 68416.m07014 F-box family protein contains F-box domain Pfam:PF00646 Length = 457 Score = 29.5 bits (63), Expect = 2.1 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = +1 Query: 187 SWKLWFLSANIDSSNLNRVHIYCVRDDSSGDSEF 288 +W+LW S + SS+L R+ I + D+ DS+F Sbjct: 204 NWELWKWSRTVSSSSLKRLTIMRKQWDAFDDSDF 237 >At1g34500.1 68414.m04288 membrane bound O-acyl transferase (MBOAT) family protein / wax synthase-related similar to wax synthase [Simmondsia chinensis] GI:5020219; contains Pfam profile PF03062: MBOAT family Length = 341 Score = 27.5 bits (58), Expect = 8.6 Identities = 16/47 (34%), Positives = 25/47 (53%) Frame = +1 Query: 169 RDYHRQSWKLWFLSANIDSSNLNRVHIYCVRDDSSGDSEFSIYLLTF 309 +D+ + W L +S+ + S N V C R +SG + F YL+TF Sbjct: 192 QDFWGRRWNL-MVSSVLRSGIYNPVRCACQRPMNSGWARFMGYLVTF 237 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,459,435 Number of Sequences: 28952 Number of extensions: 251054 Number of successful extensions: 464 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 456 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 464 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1428369392 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -