BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30730 (696 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE014298-2330|AAF48564.2| 621|Drosophila melanogaster CG8958-PA... 33 0.49 AY118926-1|AAM50786.1| 344|Drosophila melanogaster LD23842p pro... 30 3.5 AF165113-1|AAF20172.1| 344|Drosophila melanogaster membrane imp... 30 3.5 AE014298-1058|AAS65272.1| 344|Drosophila melanogaster CG12157-P... 30 3.5 AE014298-1057|AAF46272.1| 344|Drosophila melanogaster CG12157-P... 30 3.5 AY351399-1|AAQ62883.1| 71|Drosophila melanogaster drosomycin-l... 29 4.6 AY338360-1|AAQ01202.1| 71|Drosophila melanogaster drosomycin-l... 29 4.6 AJ885086-3|CAI77201.1| 71|Drosophila melanogaster dro4 protein... 29 4.6 AJ885075-3|CAI77124.1| 71|Drosophila melanogaster dro4 protein... 29 4.6 AJ885074-3|CAI77117.1| 71|Drosophila melanogaster dro4 protein... 29 4.6 AJ885073-3|CAI77110.1| 71|Drosophila melanogaster dro4 protein... 29 4.6 AJ885072-3|CAI77103.1| 71|Drosophila melanogaster dro4 protein... 29 4.6 AJ885071-3|CAI77096.1| 71|Drosophila melanogaster dro4 protein... 29 4.6 AJ885070-3|CAI77089.1| 71|Drosophila melanogaster dro4 protein... 29 4.6 AJ885069-3|CAI77082.1| 71|Drosophila melanogaster dro4 protein... 29 4.6 AJ885068-3|CAI77075.1| 71|Drosophila melanogaster dro4 protein... 29 4.6 AJ885067-3|CAI77068.1| 71|Drosophila melanogaster dro4 protein... 29 4.6 AJ885066-3|CAI77061.1| 71|Drosophila melanogaster dro4 protein... 29 4.6 AJ885065-3|CAI77054.1| 71|Drosophila melanogaster dro4 protein... 29 4.6 AJ885064-3|CAI77047.1| 71|Drosophila melanogaster dro4 protein... 29 4.6 AJ885063-3|CAI77040.1| 71|Drosophila melanogaster dro4 protein... 29 4.6 AJ885062-3|CAI77033.1| 71|Drosophila melanogaster dro4 protein... 29 4.6 AJ885061-3|CAI77026.1| 71|Drosophila melanogaster dro4 protein... 29 4.6 AJ885060-3|CAI77019.1| 71|Drosophila melanogaster dro4 protein... 29 4.6 AJ885059-3|CAI77012.1| 71|Drosophila melanogaster dro4 protein... 29 4.6 AJ885058-3|CAI77005.1| 71|Drosophila melanogaster dro4 protein... 29 4.6 AJ885057-3|CAI76998.1| 71|Drosophila melanogaster dro4 protein... 29 4.6 AJ885056-3|CAI76991.1| 71|Drosophila melanogaster dro4 protein... 29 4.6 AE014296-634|AAN11558.1| 71|Drosophila melanogaster CG32282-PA... 29 4.6 >AE014298-2330|AAF48564.2| 621|Drosophila melanogaster CG8958-PA protein. Length = 621 Score = 32.7 bits (71), Expect = 0.49 Identities = 21/56 (37%), Positives = 30/56 (53%), Gaps = 3/56 (5%) Frame = +1 Query: 1 AKANREKVPKLLAIVTKRVL--NPTY-TVVKCVLVCIFICEFLNCHRRIPSKFRYR 159 A +++ P +L + K +L NP Y T+ + +CI I LNC RIP K R R Sbjct: 53 ALMRQKRKPGMLTVADKALLRSNPAYRTIEERKKLCILIAG-LNCFSRIPPKIRAR 107 >AY118926-1|AAM50786.1| 344|Drosophila melanogaster LD23842p protein. Length = 344 Score = 29.9 bits (64), Expect = 3.5 Identities = 21/47 (44%), Positives = 22/47 (46%), Gaps = 1/47 (2%) Frame = -3 Query: 640 PNVGPGRTRTAESCVGNSQVPSCVWVGT-AASGRTSAELQKMADLLQ 503 PNV PGR S VG S VW GT SG QK +D LQ Sbjct: 221 PNV-PGRQIAIMSVVGRYTAGSSVWSGTLGQSGLHVCYYQKASDQLQ 266 >AF165113-1|AAF20172.1| 344|Drosophila melanogaster membrane import protein protein. Length = 344 Score = 29.9 bits (64), Expect = 3.5 Identities = 21/47 (44%), Positives = 22/47 (46%), Gaps = 1/47 (2%) Frame = -3 Query: 640 PNVGPGRTRTAESCVGNSQVPSCVWVGT-AASGRTSAELQKMADLLQ 503 PNV PGR S VG S VW GT SG QK +D LQ Sbjct: 221 PNV-PGRQIAIMSVVGRYTAGSSVWSGTLGQSGLHVCYYQKASDQLQ 266 >AE014298-1058|AAS65272.1| 344|Drosophila melanogaster CG12157-PB, isoform B protein. Length = 344 Score = 29.9 bits (64), Expect = 3.5 Identities = 21/47 (44%), Positives = 22/47 (46%), Gaps = 1/47 (2%) Frame = -3 Query: 640 PNVGPGRTRTAESCVGNSQVPSCVWVGT-AASGRTSAELQKMADLLQ 503 PNV PGR S VG S VW GT SG QK +D LQ Sbjct: 221 PNV-PGRQIAIMSVVGRYTAGSSVWSGTLGQSGLHVCYYQKASDQLQ 266 >AE014298-1057|AAF46272.1| 344|Drosophila melanogaster CG12157-PA, isoform A protein. Length = 344 Score = 29.9 bits (64), Expect = 3.5 Identities = 21/47 (44%), Positives = 22/47 (46%), Gaps = 1/47 (2%) Frame = -3 Query: 640 PNVGPGRTRTAESCVGNSQVPSCVWVGT-AASGRTSAELQKMADLLQ 503 PNV PGR S VG S VW GT SG QK +D LQ Sbjct: 221 PNV-PGRQIAIMSVVGRYTAGSSVWSGTLGQSGLHVCYYQKASDQLQ 266 >AY351399-1|AAQ62883.1| 71|Drosophila melanogaster drosomycin-like F protein. Length = 71 Score = 29.5 bits (63), Expect = 4.6 Identities = 14/36 (38%), Positives = 17/36 (47%), Gaps = 2/36 (5%) Frame = -2 Query: 635 CGSWKDPHCRELCREQPGTIL--CMGGYCCKWSHQC 534 C +W CR LCRE+ G + C C W QC Sbjct: 38 CWAWDGEQCRRLCREE-GRVSGHCSASLKC-WCEQC 71 >AY338360-1|AAQ01202.1| 71|Drosophila melanogaster drosomycin-like F protein. Length = 71 Score = 29.5 bits (63), Expect = 4.6 Identities = 14/36 (38%), Positives = 17/36 (47%), Gaps = 2/36 (5%) Frame = -2 Query: 635 CGSWKDPHCRELCREQPGTIL--CMGGYCCKWSHQC 534 C +W CR LCRE+ G + C C W QC Sbjct: 38 CWAWDGEQCRRLCREE-GRVSGHCSASLKC-WCEQC 71 >AJ885086-3|CAI77201.1| 71|Drosophila melanogaster dro4 protein protein. Length = 71 Score = 29.5 bits (63), Expect = 4.6 Identities = 14/36 (38%), Positives = 17/36 (47%), Gaps = 2/36 (5%) Frame = -2 Query: 635 CGSWKDPHCRELCREQPGTIL--CMGGYCCKWSHQC 534 C +W CR LCRE+ G + C C W QC Sbjct: 38 CWAWDGEQCRRLCREE-GRVSGHCSASLKC-WCEQC 71 >AJ885075-3|CAI77124.1| 71|Drosophila melanogaster dro4 protein protein. Length = 71 Score = 29.5 bits (63), Expect = 4.6 Identities = 14/36 (38%), Positives = 17/36 (47%), Gaps = 2/36 (5%) Frame = -2 Query: 635 CGSWKDPHCRELCREQPGTIL--CMGGYCCKWSHQC 534 C +W CR LCRE+ G + C C W QC Sbjct: 38 CWAWDGEQCRRLCREE-GRVSGHCSASLKC-WCEQC 71 >AJ885074-3|CAI77117.1| 71|Drosophila melanogaster dro4 protein protein. Length = 71 Score = 29.5 bits (63), Expect = 4.6 Identities = 14/36 (38%), Positives = 17/36 (47%), Gaps = 2/36 (5%) Frame = -2 Query: 635 CGSWKDPHCRELCREQPGTIL--CMGGYCCKWSHQC 534 C +W CR LCRE+ G + C C W QC Sbjct: 38 CWAWDGEQCRRLCREE-GRVSGHCSASLKC-WCEQC 71 >AJ885073-3|CAI77110.1| 71|Drosophila melanogaster dro4 protein protein. Length = 71 Score = 29.5 bits (63), Expect = 4.6 Identities = 14/36 (38%), Positives = 17/36 (47%), Gaps = 2/36 (5%) Frame = -2 Query: 635 CGSWKDPHCRELCREQPGTIL--CMGGYCCKWSHQC 534 C +W CR LCRE+ G + C C W QC Sbjct: 38 CWAWDGEQCRRLCREE-GRVSGHCSASLKC-WCEQC 71 >AJ885072-3|CAI77103.1| 71|Drosophila melanogaster dro4 protein protein. Length = 71 Score = 29.5 bits (63), Expect = 4.6 Identities = 14/36 (38%), Positives = 17/36 (47%), Gaps = 2/36 (5%) Frame = -2 Query: 635 CGSWKDPHCRELCREQPGTIL--CMGGYCCKWSHQC 534 C +W CR LCRE+ G + C C W QC Sbjct: 38 CWAWDGEQCRRLCREE-GRVSGHCSASLKC-WCEQC 71 >AJ885071-3|CAI77096.1| 71|Drosophila melanogaster dro4 protein protein. Length = 71 Score = 29.5 bits (63), Expect = 4.6 Identities = 14/36 (38%), Positives = 17/36 (47%), Gaps = 2/36 (5%) Frame = -2 Query: 635 CGSWKDPHCRELCREQPGTIL--CMGGYCCKWSHQC 534 C +W CR LCRE+ G + C C W QC Sbjct: 38 CWAWDGEQCRRLCREE-GRVSGHCSASLKC-WCEQC 71 >AJ885070-3|CAI77089.1| 71|Drosophila melanogaster dro4 protein protein. Length = 71 Score = 29.5 bits (63), Expect = 4.6 Identities = 14/36 (38%), Positives = 17/36 (47%), Gaps = 2/36 (5%) Frame = -2 Query: 635 CGSWKDPHCRELCREQPGTIL--CMGGYCCKWSHQC 534 C +W CR LCRE+ G + C C W QC Sbjct: 38 CWAWDGEQCRRLCREE-GRVSGHCSASLKC-WCEQC 71 >AJ885069-3|CAI77082.1| 71|Drosophila melanogaster dro4 protein protein. Length = 71 Score = 29.5 bits (63), Expect = 4.6 Identities = 14/36 (38%), Positives = 17/36 (47%), Gaps = 2/36 (5%) Frame = -2 Query: 635 CGSWKDPHCRELCREQPGTIL--CMGGYCCKWSHQC 534 C +W CR LCRE+ G + C C W QC Sbjct: 38 CWAWDGEQCRRLCREE-GRVSGHCSASLKC-WCEQC 71 >AJ885068-3|CAI77075.1| 71|Drosophila melanogaster dro4 protein protein. Length = 71 Score = 29.5 bits (63), Expect = 4.6 Identities = 14/36 (38%), Positives = 17/36 (47%), Gaps = 2/36 (5%) Frame = -2 Query: 635 CGSWKDPHCRELCREQPGTIL--CMGGYCCKWSHQC 534 C +W CR LCRE+ G + C C W QC Sbjct: 38 CWAWDGEQCRRLCREE-GRVSGHCSASLKC-WCEQC 71 >AJ885067-3|CAI77068.1| 71|Drosophila melanogaster dro4 protein protein. Length = 71 Score = 29.5 bits (63), Expect = 4.6 Identities = 14/36 (38%), Positives = 17/36 (47%), Gaps = 2/36 (5%) Frame = -2 Query: 635 CGSWKDPHCRELCREQPGTIL--CMGGYCCKWSHQC 534 C +W CR LCRE+ G + C C W QC Sbjct: 38 CWAWDGEQCRRLCREE-GRVSGHCSASLKC-WCEQC 71 >AJ885066-3|CAI77061.1| 71|Drosophila melanogaster dro4 protein protein. Length = 71 Score = 29.5 bits (63), Expect = 4.6 Identities = 14/36 (38%), Positives = 17/36 (47%), Gaps = 2/36 (5%) Frame = -2 Query: 635 CGSWKDPHCRELCREQPGTIL--CMGGYCCKWSHQC 534 C +W CR LCRE+ G + C C W QC Sbjct: 38 CWAWDGEQCRRLCREE-GRVSGHCSASLKC-WCEQC 71 >AJ885065-3|CAI77054.1| 71|Drosophila melanogaster dro4 protein protein. Length = 71 Score = 29.5 bits (63), Expect = 4.6 Identities = 14/36 (38%), Positives = 17/36 (47%), Gaps = 2/36 (5%) Frame = -2 Query: 635 CGSWKDPHCRELCREQPGTIL--CMGGYCCKWSHQC 534 C +W CR LCRE+ G + C C W QC Sbjct: 38 CWAWDGEQCRRLCREE-GRVSGHCSASLKC-WCEQC 71 >AJ885064-3|CAI77047.1| 71|Drosophila melanogaster dro4 protein protein. Length = 71 Score = 29.5 bits (63), Expect = 4.6 Identities = 14/36 (38%), Positives = 17/36 (47%), Gaps = 2/36 (5%) Frame = -2 Query: 635 CGSWKDPHCRELCREQPGTIL--CMGGYCCKWSHQC 534 C +W CR LCRE+ G + C C W QC Sbjct: 38 CWAWDGEQCRRLCREE-GRVSGHCSASLKC-WCEQC 71 >AJ885063-3|CAI77040.1| 71|Drosophila melanogaster dro4 protein protein. Length = 71 Score = 29.5 bits (63), Expect = 4.6 Identities = 14/36 (38%), Positives = 17/36 (47%), Gaps = 2/36 (5%) Frame = -2 Query: 635 CGSWKDPHCRELCREQPGTIL--CMGGYCCKWSHQC 534 C +W CR LCRE+ G + C C W QC Sbjct: 38 CWAWDGEQCRRLCREE-GRVSGHCSASLKC-WCEQC 71 >AJ885062-3|CAI77033.1| 71|Drosophila melanogaster dro4 protein protein. Length = 71 Score = 29.5 bits (63), Expect = 4.6 Identities = 14/36 (38%), Positives = 17/36 (47%), Gaps = 2/36 (5%) Frame = -2 Query: 635 CGSWKDPHCRELCREQPGTIL--CMGGYCCKWSHQC 534 C +W CR LCRE+ G + C C W QC Sbjct: 38 CWAWDGEQCRRLCREE-GRVSGHCSASLKC-WCEQC 71 >AJ885061-3|CAI77026.1| 71|Drosophila melanogaster dro4 protein protein. Length = 71 Score = 29.5 bits (63), Expect = 4.6 Identities = 14/36 (38%), Positives = 17/36 (47%), Gaps = 2/36 (5%) Frame = -2 Query: 635 CGSWKDPHCRELCREQPGTIL--CMGGYCCKWSHQC 534 C +W CR LCRE+ G + C C W QC Sbjct: 38 CWAWDGEQCRRLCREE-GRVSGHCSASLKC-WCEQC 71 >AJ885060-3|CAI77019.1| 71|Drosophila melanogaster dro4 protein protein. Length = 71 Score = 29.5 bits (63), Expect = 4.6 Identities = 14/36 (38%), Positives = 17/36 (47%), Gaps = 2/36 (5%) Frame = -2 Query: 635 CGSWKDPHCRELCREQPGTIL--CMGGYCCKWSHQC 534 C +W CR LCRE+ G + C C W QC Sbjct: 38 CWAWDGEQCRRLCREE-GRVSGHCSASLKC-WCEQC 71 >AJ885059-3|CAI77012.1| 71|Drosophila melanogaster dro4 protein protein. Length = 71 Score = 29.5 bits (63), Expect = 4.6 Identities = 14/36 (38%), Positives = 17/36 (47%), Gaps = 2/36 (5%) Frame = -2 Query: 635 CGSWKDPHCRELCREQPGTIL--CMGGYCCKWSHQC 534 C +W CR LCRE+ G + C C W QC Sbjct: 38 CWAWDGEQCRRLCREE-GRVSGHCSASLKC-WCEQC 71 >AJ885058-3|CAI77005.1| 71|Drosophila melanogaster dro4 protein protein. Length = 71 Score = 29.5 bits (63), Expect = 4.6 Identities = 14/36 (38%), Positives = 17/36 (47%), Gaps = 2/36 (5%) Frame = -2 Query: 635 CGSWKDPHCRELCREQPGTIL--CMGGYCCKWSHQC 534 C +W CR LCRE+ G + C C W QC Sbjct: 38 CWAWDGEQCRRLCREE-GRVSGHCSASLKC-WCEQC 71 >AJ885057-3|CAI76998.1| 71|Drosophila melanogaster dro4 protein protein. Length = 71 Score = 29.5 bits (63), Expect = 4.6 Identities = 14/36 (38%), Positives = 17/36 (47%), Gaps = 2/36 (5%) Frame = -2 Query: 635 CGSWKDPHCRELCREQPGTIL--CMGGYCCKWSHQC 534 C +W CR LCRE+ G + C C W QC Sbjct: 38 CWAWDGEQCRRLCREE-GRVSGHCSASLKC-WCEQC 71 >AJ885056-3|CAI76991.1| 71|Drosophila melanogaster dro4 protein protein. Length = 71 Score = 29.5 bits (63), Expect = 4.6 Identities = 14/36 (38%), Positives = 17/36 (47%), Gaps = 2/36 (5%) Frame = -2 Query: 635 CGSWKDPHCRELCREQPGTIL--CMGGYCCKWSHQC 534 C +W CR LCRE+ G + C C W QC Sbjct: 38 CWAWDGEQCRRLCREE-GRVSGHCSASLKC-WCEQC 71 >AE014296-634|AAN11558.1| 71|Drosophila melanogaster CG32282-PA protein. Length = 71 Score = 29.5 bits (63), Expect = 4.6 Identities = 14/36 (38%), Positives = 17/36 (47%), Gaps = 2/36 (5%) Frame = -2 Query: 635 CGSWKDPHCRELCREQPGTIL--CMGGYCCKWSHQC 534 C +W CR LCRE+ G + C C W QC Sbjct: 38 CWAWDGEQCRRLCREE-GRVSGHCSASLKC-WCEQC 71 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 32,896,041 Number of Sequences: 53049 Number of extensions: 727634 Number of successful extensions: 1907 Number of sequences better than 10.0: 29 Number of HSP's better than 10.0 without gapping: 1787 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1907 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3046624548 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -