BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30730 (696 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g65600.1 68418.m08253 legume lectin family protein / protein ... 28 5.1 At1g61710.1 68414.m06960 DC1 domain-containing protein contains ... 28 6.8 At1g60050.1 68414.m06765 nodulin-related low similarity to MtN21... 27 9.0 At1g53490.1 68414.m06064 bZIP protein 27 9.0 >At5g65600.1 68418.m08253 legume lectin family protein / protein kinase family protein contains Pfam domains PF00138: Legume lectins alpha domain, PF00139: Legume lectins beta domain and PF00069: Protein kinase domain Length = 675 Score = 28.3 bits (60), Expect = 5.1 Identities = 13/48 (27%), Positives = 25/48 (52%) Frame = +1 Query: 466 KNKMLSAARLIAPAAGLPSSATLHWCDHLQQYPPIHRMVPGCSLHSSL 609 KN+ L+ ++I+ + WC+ ++ I+ +VP SL+S L Sbjct: 389 KNEFLNEVKIISKLRHRNLVQLIGWCNEKNEFLLIYELVPNGSLNSHL 436 >At1g61710.1 68414.m06960 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 402 Score = 27.9 bits (59), Expect = 6.8 Identities = 15/34 (44%), Positives = 21/34 (61%), Gaps = 2/34 (5%) Frame = +2 Query: 464 IKTKCCLPPD*SPLQQVCHLLQL--CTGATTCSS 559 I ++ LPP S LQ+V H++Q C GAT +S Sbjct: 53 IFSRSILPPSSSSLQEVLHIIQYSRCFGATIKNS 86 >At1g60050.1 68414.m06765 nodulin-related low similarity to MtN21 [Medicago truncatula] GI:2598575; contains Pfam profile PF00892: Integral membrane protein Length = 374 Score = 27.5 bits (58), Expect = 9.0 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +1 Query: 544 DHLQQYPPIHRMVPGCSLHSSLQCGSF 624 D +Q+YP + ++V SL +LQC F Sbjct: 217 DTVQKYPQVMKVVSAYSLAGTLQCAIF 243 >At1g53490.1 68414.m06064 bZIP protein Length = 229 Score = 27.5 bits (58), Expect = 9.0 Identities = 16/46 (34%), Positives = 20/46 (43%), Gaps = 2/46 (4%) Frame = -1 Query: 696 PSPQMEIWPARSQMPPLSDRMWVLEGPALQRAV*G--TARYHPVYG 565 P P+ EIWPAR + PA+ + R HPVYG Sbjct: 151 PGPKDEIWPARQNSSNSGPFDISTDSPAIPSDLGNRRAGRGHPVYG 196 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,681,148 Number of Sequences: 28952 Number of extensions: 332535 Number of successful extensions: 799 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 783 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 799 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1487069504 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -