BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30729 (660 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC23G3.01 |rpb2|SPAC521.06|DNA-directed RNA polymerase II comp... 25 7.3 SPBC1604.02c |||PPR repeat protein|Schizosaccharomyces pombe|chr... 25 9.7 SPBC1861.02 |abp2||ARS binding protein Abp2|Schizosaccharomyces ... 25 9.7 >SPAC23G3.01 |rpb2|SPAC521.06|DNA-directed RNA polymerase II complex subunit Rpb2|Schizosaccharomyces pombe|chr 1|||Manual Length = 1210 Score = 25.4 bits (53), Expect = 7.3 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = -2 Query: 596 DLNECPRDSGG 564 DLNECP D GG Sbjct: 176 DLNECPYDQGG 186 >SPBC1604.02c |||PPR repeat protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 697 Score = 25.0 bits (52), Expect = 9.7 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = +3 Query: 504 NQDFVK*VLFRRLKW*ETCRPTRVARTFV 590 NQDF+ + + + C+P R+ +TF+ Sbjct: 116 NQDFIDCCIIACSAYEKLCQPLRIKKTFI 144 >SPBC1861.02 |abp2||ARS binding protein Abp2|Schizosaccharomyces pombe|chr 2|||Manual Length = 527 Score = 25.0 bits (52), Expect = 9.7 Identities = 13/32 (40%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Frame = -2 Query: 653 AEAVGPAPRMPPELDRGPPDLNE--CPRDSGG 564 AEAVG A + P+ + P DL + P++S G Sbjct: 273 AEAVGVADSIDPDWHQWPDDLRDVSSPKESDG 304 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,429,324 Number of Sequences: 5004 Number of extensions: 45008 Number of successful extensions: 94 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 92 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 94 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 299817502 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -