BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30729 (660 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g59300.1 68416.m06610 expressed protein hypothetical protein ... 30 1.2 At5g48550.1 68418.m06003 F-box family protein-related similar to... 28 4.8 >At3g59300.1 68416.m06610 expressed protein hypothetical protein T2J13.20 - Arabidopsis thaliana, PIR:T46116 Length = 459 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/26 (53%), Positives = 16/26 (61%) Frame = +2 Query: 569 PSREDIRLDPGAPGPVRAAFGARGPR 646 P E+I DPGA PV+A FG PR Sbjct: 166 PDDENILEDPGASNPVKAFFGMDVPR 191 >At5g48550.1 68418.m06003 F-box family protein-related similar to unknown protein (gb AAF19735.1); contains TIGRFAM TIGR01640 : F-box protein interaction domain Length = 427 Score = 28.3 bits (60), Expect = 4.8 Identities = 14/46 (30%), Positives = 18/46 (39%) Frame = -3 Query: 643 WAPRPECRPNWTGGPRI*TNVLATRVGLHVSYHFNLLNRTHFTKSW 506 W R + R W+ R NV +VG H NR H +W Sbjct: 246 WTLRDKARGEWSFDYRFDANVFRDKVGCFCRGHDWSTNRLHVVGAW 291 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,858,626 Number of Sequences: 28952 Number of extensions: 243510 Number of successful extensions: 538 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 529 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 538 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1383534864 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -