BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30727 (719 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC821.07c |moc3||transcription factor Moc3|Schizosaccharomyces... 27 2.0 SPBC336.03 |efc25||exchange factor Cdc25p-like|Schizosaccharomyc... 26 6.2 >SPAC821.07c |moc3||transcription factor Moc3|Schizosaccharomyces pombe|chr 1|||Manual Length = 497 Score = 27.5 bits (58), Expect = 2.0 Identities = 18/56 (32%), Positives = 23/56 (41%) Frame = -1 Query: 698 INLGGFPKAKQSSK*LLSNPNLPIKKLPKNVHGPPINFSLKVSLRVYPIIISSRNF 531 +NL GFP A Q + L SN N+P + V YP + S NF Sbjct: 145 MNLQGFPSAYQQHQYLQSNHNVPTNNSSSATSSTKPSVQ-SVGQASYPFLSSVSNF 199 >SPBC336.03 |efc25||exchange factor Cdc25p-like|Schizosaccharomyces pombe|chr 2|||Manual Length = 987 Score = 25.8 bits (54), Expect = 6.2 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +3 Query: 309 KLLWFLLPNC*RFCANKLDY 368 K +WFLL NC F N D+ Sbjct: 381 KCVWFLLKNCDEFIENFSDF 400 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,775,162 Number of Sequences: 5004 Number of extensions: 52669 Number of successful extensions: 104 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 103 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 104 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 337208592 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -